Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human tonsil stained with anti-PD-1 antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of germinal center T-cells

rabbit anti-PD-1 (PDCD1) monoclonal antibody (ZR408) 6327

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to PD-1 (PDCD1)
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Lymph node
Visualization: Cytoplasm & Membrane
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6327parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, General & Epithelial Markers, monoclonal, PD-1 (PDCD1)

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-PD-1 (PDCD1) monoclonal antibody ZR408 6327

antibody
Database link: human Q15116
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Lymph node
Immunogen Recombinant fragment corresponding to extracellular domain of human PDCD1 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens PDCD1 Programmed cell death protein 1
Protein names Programmed cell death protein 1
Gene names PDCD1
Function Inhibitory receptor on antigen activated T-cells that plays a critical role in induction and maintenance of immune tolerance to self (PubMed:21276005, PubMed:31754127, PubMed:32184441, PubMed:37208329). Delivers inhibitory signals upon binding to ligands CD274/PDCD1L1 and CD273/PDCD1LG2 (PubMed:21276005, PubMed:26602187). Following T-cell receptor (TCR) engagement, PDCD1 associates with TCR-CD3 in the immunological synapse and directly inhibits T-cell activation (PubMed:32184441). Suppresses T-cell activation through the recruitment of PTPN11/SHP-2: following ligand-binding, PDCD1 is phosphorylated within the ITSM motif, leading to the recruitment of the protein tyrosine phosphatase PTPN11/SHP-2 that mediates dephosphorylation of key TCR proximal signaling molecules, such as ZAP70, PRKCQ/PKCtheta and CD247/CD3zeta (PubMed:32184441)
Subcellular location Cell membrane
Structure Monomer
Post-translational modification Ubiquitinated at Lys-233 by the SCF(FBXO38) complex, leading to its proteasomal degradation (PubMed:30487606). Ubiquitinated via 'Lys-48'-linked polyubiquitin chains (PubMed:30487606). Deubiquitinated and thus stabilized by USP5 (PubMed:37208329) Tyrosine phosphorylated at Tyr-223 (within ITIM motif) and Tyr-248 (ITSM motif) upon ligand binding (PubMed:31754127, PubMed:32184441). Phosphorylation at Tyr-248 by FYN promotes the recruitment of the protein tyrosine phosphatase PTPN11/SHP-2 that mediates dephosphorylation of key TCR proximal signaling molecules, such as ZAP70, PRKCQ/PKCtheta and CD247/CD3zeta (PubMed:32184441). Phosphorylation at Thr-234 promotes the recruitment of the deubiquitinase USP5 (PubMed:37208329) N-glycosylation at Asn-58 contains at least two N-acetylglucosamine units and one fucose (PubMed:28165004). N-glycosylation does not affect binding to nivolumab drug (PubMed:28165004)
Involvement in disease Autoimmune disease, multisystem, infantile-onset, 4 An autosomal recessive immunologic disorder characterized by lymphoproliferative autoimmunity and onset of various autoimmune diseases in early childhood. Death from autoimmune pneumonitis may occur.
Keywords 3D-structure, Adaptive immunity, Apoptosis, Cell membrane, Disulfide bond, Glycoprotein, Immunity, Immunoglobulin domain, Isopeptide bond, Membrane, Phosphoprotein, Proteomics identification, Reference proteome, Signal, Transmembrane, Transmembrane helix, Ubl conjugation
Sequence MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTS ESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGT YLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGS LVLLVWVLAVICSRAARGTIGARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVP CVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL
UniProt accession: Q15116

Data

Formalin-fixed, paraffin-embedded human tonsil stained with anti-PD-1 antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of germinal center T-cells

FAQ & Publications

Frequently Asked Questions

What species is the rabbit anti-PD-1 (PDCD1) monoclonal antibody (ZR408) reactive with?

This antibody is reactive with human PD-1 (PDCD1) protein.

What are the recommended storage conditions for the rabbit anti-PD-1 (PDCD1) monoclonal antibody?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C. Avoid repeated freeze/thaw cycles to maintain antibody stability.

Which applications is the rabbit anti-PD-1 (PDCD1) monoclonal antibody validated for?

This antibody is suitable and validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues.

What is the host species and clonality of the anti-PD-1 (PDCD1) antibody ZR408?

The antibody is a rabbit monoclonal antibody, ensuring high specificity and affinity for PD-1.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.