| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | P73 (Phospho-Tyr99) |
| available sizes | 100 µL |
rabbit anti-P73 (Phospho-Tyr99) polyclonal antibody 8924
$366.00
Antibody summary
- Rabbit polyclonal to P73 (Phospho-Tyr99)
- Suitable for: WB
- Isotype: Whole IgG
- 100 µl
rabbit anti-P73 (Phospho-Tyr99) polyclonal antibody 8924
| antibody |
|---|
| Tested applications WB |
| Recommended dilutions Immunoblotting: use at dilution of 1:500-1:1,000. A band of ~80kDa is detected. These are recommended working dilutions. End user should determine optimal dilutions for their applications. |
| Immunogen Peptide sequence that includes phosphorylation site of tyrosine 99 (S-P-Y(p)-A-Q) derived from human p73. |
| Size and concentration 100µL and 1 mg/mL |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. |
| Storage buffer PBS (without Mg2 and Ca2 ), pH 7.4, 150mM NaCl, |
| Purity affinity purified |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens TP73 Tumor protein p73 |
| Protein names Tumor protein p73 |
| Alternative names p53-like transcription factor, p53-related protein |
| Gene names TP73 |
| Protein family Belongs to the p53 family |
| Function Participates in the apoptotic response to DNA damage. Isoforms containing the transactivation domain are pro-apoptotic, isoforms lacking the domain are anti-apoptotic and block the function of p53 and transactivating p73 isoforms. May be a tumor suppressor protein. Is an activator of FOXJ1 expression (By similarity). It is an essential factor for the positive regulation of lung ciliated cell differentiation (PubMed:34077761) |
| Subcellular location Nucleus, Cytoplasm |
| Structure (Microbial infection) Interacts with Epstein-Barr virus protein EBNA6; this interaction inhibits TP73-mediated apoptotic pathway |
| Post-translational modification Isoform alpha (but not isoform beta) is sumoylated on Lys-627, which potentiates proteasomal degradation but does not affect transcriptional activity. Phosphorylation by PLK1 and PLK3 inhibits the transcription regulator activity and pro-apoptotic function Higher levels of phosphorylation seen in the brain from patients with Huntington disease Polyubiquitinated by RCHY1/PIRH2; leading to its degradation by the proteasome |
| Involvement in disease Ciliary dyskinesia, primary, 47, and lissencephaly A form of primary ciliary dyskinesia, a disorder characterized by abnormalities of motile cilia. Respiratory infections leading to chronic inflammation and bronchiectasis are recurrent, due to defects in the respiratory cilia. CILD47 is an autosomal recessive form characterized by onset soon after birth or in early childhood. Affected individuals also have neurologic features, such as impaired intellectual development and central hypotonia, associated with structural brain abnormalities, most notably lissencephaly and thin or absent corpus callosum. No situs abnormalities have been observed. |
| Keywords 3D-structure, Activator, Alternative promoter usage, Alternative splicing, Apoptosis, Cell cycle, Ciliopathy, Cytoplasm, Disease variant, DNA-binding, Host-virus interaction, Isopeptide bond, Lissencephaly, Metal-binding, Nucleus, Phosphoprotein, Primary ciliary dyskinesia, Proteomics identification, Reference proteome, Transcription, Transcription regulation, Tumor suppressor, Ubl conjugation, Zinc |
| Sequence MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTS VMAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTMSPAPVIPSNTD YPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPV YKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPY EPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGR DRKADEDHYREQQALNESSAKNGAASKRAFKQSPPAVPALGAGVKKRRHGDEDTYYLQVR GRENFEILMKLKESLELMELVPQPLVDSYRQQQQLLQRPSHLQPPSYGPVLSPMNKVHGG MNKLPSVNQLVGQPPPHSSAATPNLGPVGPGMLNNHGHAVPANGEMSSSHSAQSMVSGSH CTPPPPYHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMT IWRGLQDLKQGHDYSTAQQLLRSSNAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRG GPGGGPDEWADFGFDLPDCKARKQPIKEEFTEAEIH |
| UniProt accession: O15350 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What is the recommended dilution range for using the rabbit anti-P73 (Phospho-Tyr99) polyclonal antibody in Western blotting?
For immunoblotting (Western blot), the recommended dilution range is 1:500 to 1:1,000, with an expected band at approximately 80 kDa. Users should optimize the dilution for their specific applications.
How should the rabbit anti-P73 (Phospho-Tyr99) polyclonal antibody be stored to maintain stability?
This antibody is stable for at least one year when stored at -20°C. It is supplied in PBS without Mg2+ and Ca2+, pH 7.4, with 150 mM NaCl.
Which secondary antibodies are compatible with the rabbit anti-P73 (Phospho-Tyr99) polyclonal antibody?
Compatible secondary antibodies include goat anti-rabbit IgG H&L chain specific antibodies conjugated to peroxidase, biotin, or FITC, including cross-absorbed versions to reduce cross-reactivity.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.