| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ELISA, IHC |
| available sizes | 100 µg |
rabbit anti-CCL5 polyclonal antibody 5603
$300.00
Antibody summary
- Rabbit polyclonal to CCL5 (pan)
- Suitable for: ELISA, IHC
- Reacts with: human, mouse, rat
- Isotype: IgG
- 100 µg
rabbit anti-CCL5 polyclonal antibody 5603
| target relevance |
|---|
| Homo sapiens CCL5 C-C motif chemokine 5 |
| Protein names C-C motif chemokine 5 |
| Alternative names EoCP, Eosinophil chemotactic cytokine, SIS-delta, Small-inducible cytokine A5, T cell-specific protein P228, T-cell-specific protein RANTES |
| Gene names CCL5 |
| Protein family Belongs to the intercrine beta (chemokine CC) family |
| Function Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) (PubMed:1380064, PubMed:15923218, PubMed:16791620, PubMed:8525373, PubMed:9516414). May also be an agonist of the G protein-coupled receptor GPR75, stimulating inositol trisphosphate production and calcium mobilization through its activation. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells (PubMed:23979485) |
| Subcellular location Secreted |
| Structure Homo and heterooligomers with other chemokines. Interacts with the brown dog tick evasin-4 |
| Post-translational modification N-terminal processed form RANTES(3-68) is produced by proteolytic cleavage, probably by DPP4, after secretion from peripheral blood leukocytes and cultured sarcoma cells N-terminal processed form RANTES(4-68) is produced by proteolytic cleavage by cathepsin CTSG The identity of the O-linked saccharides at Ser-27 and Ser-28 are not reported in PubMed:1380064. They are assigned by similarity |
| Keywords 3D-structure, Chemotaxis, Cytokine, Direct protein sequencing, Disulfide bond, Glycoprotein, Inflammatory response, Oxidation, Proteomics identification, Reference proteome, Secreted, Signal |
| Sequence MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNP AVVFVTRKNRQVCANPEKKWVREYINSLEMS |
| UniProt accession: P13501 |
Data
 |
| [vial] |
FAQ & Publications
Frequently Asked Questions
What species does the rabbit anti-CCL5 polyclonal antibody 5603 react with?
The rabbit anti-CCL5 polyclonal antibody 5603 reacts with human, mouse, and rat species.
How should the rabbit anti-CCL5 polyclonal antibody 5603 be stored upon receipt to maintain stability?
Upon receipt, the antibody should be stored at -20°C or -80°C and repeated freeze-thaw cycles should be avoided to maintain stability.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.