Skip to content

rabbit anti-CCL5 polyclonal antibody 5601

$350.00

Antibody summary

  • Rabbit polyclonal to CCL5 (pan)
  • Suitable for: ELISA, IHC
  • Reacts with: human, mouse, rat
  • Isotype: IgG
  • 100 µg
SKU: 5601 Category: Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

rabbit

isotype

IgG

clonality

polyclonal

concentration

1 mg/mL

applications

ELISA, IHC

available sizes

100 µg

rabbit anti-CCL5 polyclonal antibody 5601

antibody
Database link:
CCL5 (rantes) P13501
Tested applications
IHC, ELISA
Recommended dilutions
WB 1:1000-1:5000
Immunogen
C-terminal region of Human RANTES
Size and concentration
100µg and 1 mg/mL
Form
liquid
Storage Instructions
Upon receipt, store at -20°C or -80°C. Avoid repeated freeze.
Storage buffer
Preservative: 0.03% Proclin 300 Constituents: 50% Glycerol, 0.01M PBS, PH 7.4
Purity
affinity purified
Clonality
polyclonal
Isotype
IgG
Compatible secondaries
goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863
goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control
Rabbit polyclonal - Isotype Control
target relevance
Homo sapiens CCL5
C-C motif chemokine 5
Protein names
C-C motif chemokine 5
Alternative names
EoCP, Eosinophil chemotactic cytokine, SIS-delta, Small-inducible cytokine A5, T cell-specific protein P228, T-cell-specific protein RANTES
Gene names
CCL5
Protein family
Belongs to the intercrine beta (chemokine CC) family
Function
Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) (PubMed:1380064, PubMed:15923218, PubMed:16791620, PubMed:8525373, PubMed:9516414). May also be an agonist of the G protein-coupled receptor GPR75, stimulating inositol trisphosphate production and calcium mobilization through its activation. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells (PubMed:23979485)
Subcellular location
Secreted
Structure
Homo and heterooligomers with other chemokines. Interacts with the brown dog tick evasin-4
Post-translational modification
N-terminal processed form RANTES(3-68) is produced by proteolytic cleavage, probably by DPP4, after secretion from peripheral blood leukocytes and cultured sarcoma cells
N-terminal processed form RANTES(4-68) is produced by proteolytic cleavage by cathepsin CTSG
The identity of the O-linked saccharides at Ser-27 and Ser-28 are not reported in PubMed:1380064. They are assigned by similarity
Keywords
3D-structure, Chemotaxis, Cytokine, Direct protein sequencing, Disulfide bond, Glycoprotein, Inflammatory response, Oxidation, Proteomics identification, Reference proteome, Secreted, Signal
Sequence
MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNP AVVFVTRKNRQVCANPEKKWVREYINSLEMS
UniProt accession: P13501

Data


Western blot
All lanes: CCL5 antibody at 2µg/ml
Lane 1: EC109 whole cell lysate
Lane 2: 293T whole cell lysate
Secondary
Goat polyclonal to rabbit IgG at 1/15000 dilution
Predicted band size: 10 kDa
Observed band size: 70 kDa
Western blot All lanes: CCL5 antibody at 2µg/ml Lane 1: EC109 whole cell lysate Lane 2: 293T whole cell lysate Secondary Goat polyclonal to rabbit IgG at 1/15000 dilution Predicted band size: 10 kDa Observed band size: 70 kDa

FAQ & Publications

Frequently Asked Questions
What species does the rabbit anti-CCL5 polyclonal antibody 5601 react with?
This antibody reacts with human, mouse, and rat species.
Which applications is the rabbit anti-CCL5 polyclonal antibody 5601 validated for?
It is suitable and tested for use in ELISA and immunohistochemistry (IHC) applications.
How should the rabbit anti-CCL5 polyclonal antibody 5601 be stored to maintain stability?
Upon receipt, store the antibody at -20°C or -80°C and avoid repeated freeze-thaw cycles.
What is the immunogen used to produce the rabbit anti-CCL5 polyclonal antibody 5601?
The immunogen is the C-terminal region of Human RANTES (CCL5).
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
IHC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.