Immunohistochemistry (IHC) : Human breast lobular carcinoma stained with anti-P120 antibody using peroxidase-conjugate and DAB chromogen. Note: the cytoplasmic staining of lobular carcinoma cells and membranous staining of ductal epithelium (lower field).

rabbit anti-p120 monoclonal antibody (ZR316) 6302

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to p120
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Breast lobular carcinoma, melanoma
Visualization: Cytoplasmic and membranous
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6302parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Breast Pathology, monoclonal, p120

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-p120 monoclonal antibody ZR316 6302

antibody
Database link: human O14601
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Breast lobular carcinoma, melanoma
Immunogen Fragment (around aa 900-1,000) of human CTNND1 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens CTNND1 Catenin delta-1
Protein names Catenin delta-1
Alternative names Cadherin-associated Src substrate, p120 catenin, p120(cas)
Gene names CTNND1
Protein family Belongs to the beta-catenin family
Function Key regulator of cell-cell adhesion that associates with and regulates the cell adhesion properties of both C-, E- and N-cadherins, being critical for their surface stability (PubMed:14610055, PubMed:20371349). Promotes localization and retention of DSG3 at cell-cell junctions, via its interaction with DSG3 (PubMed:18343367). Beside cell-cell adhesion, regulates gene transcription through several transcription factors including ZBTB33/Kaiso2 and GLIS2, and the activity of Rho family GTPases and downstream cytoskeletal dynamics (PubMed:10207085, PubMed:20371349). Implicated both in cell transformation by SRC and in ligand-induced receptor signaling through the EGF, PDGF, CSF-1 and ERBB2 receptors (PubMed:17344476)
Subcellular location Cytoplasm
Structure Belongs to a multiprotein cell-cell adhesion complex that also contains E-cadherin/CDH1, alpha-catenin/CTNNA1, beta-catenin/CTNNB1, and gamma-catenin/JUP (PubMed:15240885, PubMed:20371349). Component of a cadherin:catenin adhesion complex composed of at least of CDH26, beta-catenin/CTNNB1, alpha-catenin/CTNNA1 and p120 catenin/CTNND1 (PubMed:28051089). Binds to the C-terminal fragment of PSEN1 and mutually competes for CDH1. Interacts with ZBTB33 (PubMed:10207085). Interacts with GLIS2 (PubMed:17344476). Interacts with FER (PubMed:7623846). Interacts with NANOS1 (via N-terminal region) (PubMed:17047063). Interacts (via N-terminus) with GNA12; the interaction regulates CDH1-mediated cell-cell adhesion (PubMed:15240885). Interacts with GNA13 (PubMed:15240885). Interacts with CCDC85B (PubMed:25009281). Interacts with PLPP3; negatively regulates the PLPP3-mediated stabilization of CTNNB1 (PubMed:20123964). Interacts with DSG3; the interaction facilitates DSG3 localization and retention at cell-cell junctions (PubMed:18343367). Interacts with CTNND1/p120-catenin; the interaction controls CADH5 endocytosis (By similarity)
Post-translational modification Phosphorylated by FER and other protein-tyrosine kinases. Phosphorylated at Ser-288 by PAK5. Dephosphorylated by PTPRJ
Involvement in disease Blepharocheilodontic syndrome 2 A form of blepharocheilodontic syndrome, a rare autosomal dominant disorder. It is characterized by lower eyelid ectropion, upper eyelid distichiasis, euryblepharon, bilateral cleft lip and palate, and features of ectodermal dysplasia, including hair anomalies, conical teeth and tooth agenesis. An additional rare manifestation is imperforate anus. There is considerable phenotypic variability among affected individuals.
Keywords 3D-structure, Acetylation, Alternative initiation, Alternative splicing, Cell adhesion, Cell junction, Cell membrane, Coiled coil, Cytoplasm, Disease variant, Ectodermal dysplasia, Isopeptide bond, Membrane, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Repeat, Transcription, Transcription regulation, Ubl conjugation, Wnt signaling pathway
Sequence MDDSEVESTASILASVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDANPLMANGTL TRRHQNGRFVGDADLERQKFSDLKLNGPQDHSHLLYSTIPRMQEPGQIVETYTEEDPEGA MSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGR DFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEER YRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPYGLEDDQRSMGYDDLDYGMMS DYGTARRTGTPSDPRRRLRSYEDMIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPP PNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHP KKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLS SHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSE RSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERY QEAAPNVANNTGPHAASCFGAKKGKDEWFSRGKKPIEDPANDTVDFPKRTSPARGYELLF QPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLT NEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILN TINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLE KEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSL DNNYSTPNERGDHNRTLDRSGDLGDMEPLKGTTPLMQDEGQESLEEELDVLVLDDEGGQV SYPSMQKI
UniProt accession: O60716

Data

Human breast lobular carcinoma stained with anti-P120 antibody using peroxidase-conjugate and DAB chromogen. Note: the cytoplasmic staining of lobular carcinoma cells and membranous staining of ductal epithelium (lower field).

FAQ & Publications

Frequently Asked Questions

What is the recommended application and dilution range for the rabbit anti-p120 monoclonal antibody (ZR316)?

This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissue samples. The recommended dilution for the concentrated antibody is between 1:100 and 1:200.

How should the rabbit anti-p120 monoclonal antibody (ZR316) be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For longer-term storage, it should be kept at -20°C. It is important to avoid freeze/thaw cycles to preserve antibody integrity.

What species does the rabbit anti-p120 monoclonal antibody (ZR316) react with, and what controls are recommended for validation?

This antibody reacts specifically with human p120 protein. Positive controls recommended for immunohistochemistry validation include breast lobular carcinoma and melanoma tissue samples.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.