Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human NUT carcinoma stained with anti-NUT antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of tumor cells

rabbit anti-NUT monoclonal antibody (ZR453) 6296

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to NUT
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: NUT carcinoma
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6296parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, monoclonal, Neuropathology/Endocrine, NUT

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-NUT monoclonal antibody ZR453 6296

antibody
Database link: human Q86SE8
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: NUT carcinoma
Immunogen A peptide corresponding to human NUT protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens NPM2 Nucleoplasmin-2
Protein names Nucleoplasmin-2
Gene names NPM2
Protein family Belongs to the nucleoplasmin family
Function Core histones chaperone involved in chromatin reprogramming, specially during fertilization and early embryonic development. Probably involved in sperm DNA decondensation during fertilization
Subcellular location Nucleus
Structure Homopentamer, when bound to H2A-H2B dimers only. Homodecamer of two stacked pentamers, when bound to H2A-H2B dimers and H3-H4 tetramers simultaneously
Keywords 3D-structure, Alternative splicing, Chaperone, Chromatin regulator, Developmental protein, Fertilization, Nucleus, Proteomics identification, Reference proteome
Sequence MNLSSASSTEEKAVTTVLWGCELSQERRTWTFRPQLEGKQSCRLLLHTICLGEKAKEEMH RVEILPPANQEDKKMQPVTIASLQASVLPMVSMVGVQLSPPVTFQLRAGSGPVFLSGQER YEASDLTWEEEEEEEGEEEEEEEEDDEDEDADISLEEQSPVKQVKRLVPQKQASVAKKKK LEKEEEEIRASVRDKSPVKKAKATARAKKPGFKK
UniProt accession: Q86SE8

Data

Formalin-fixed, paraffin-embedded human NUT carcinoma stained with anti-NUT antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of tumor cells

FAQ & Publications

Frequently Asked Questions

What applications is the rabbit anti-NUT monoclonal antibody (ZR453) validated for?

This antibody is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissue samples, specifically for detecting NUT carcinoma.

How should the rabbit anti-NUT monoclonal antibody (ZR453) be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C, and freeze/thaw cycles should be avoided to preserve antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.