Immunohistochemistry (IHC) : Human cerebellum stained with anti-NSE antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of neuronal cells.

rabbit anti-NSE monoclonal antibody (ZR406) 6294

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to NSE
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Pancreas or brain
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6294parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, monoclonal, Neuropathology/Endocrine, NSE

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-NSE monoclonal antibody ZR406 6294

antibody
Database link: human P09104
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Pancreas or brain
Immunogen A synthetic peptide corresponding to aa416-433 of human NSE gamma
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens ENO2 Gamma-enolase
Protein names Gamma-enolase
Alternative names 2-phospho-D-glycerate hydro-lyase, Enolase 2, Neural enolase, Neuron-specific enolase
Gene names ENO2
Protein family Belongs to the enolase family
Function Enolase that catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate in glycolysis and the reverse reaction in gluconeogenesis (By similarity). Has neurotrophic and neuroprotective properties on a broad spectrum of central nervous system (CNS) neurons. Binds, in a calcium-dependent manner, to cultured neocortical neurons and promotes cell survival (By similarity)
Catalytic activity (2R)-2-phosphoglycerate = phosphoenolpyruvate + H2O
Subcellular location Cytoplasm, Cell membrane
Structure Mammalian enolase is composed of 3 isozyme subunits, alpha, beta and gamma, which can form homodimers or heterodimers which are cell-type and development-specific
Keywords 3D-structure, Acetylation, Alternative splicing, Cell membrane, Cytoplasm, Direct protein sequencing, Glycolysis, Hydroxylation, Isopeptide bond, Lyase, Magnesium, Membrane, Metal-binding, Phosphoprotein, Proteomics identification, Reference proteome, Ubl conjugation
Sequence MSIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGK GVLKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCK AGAAERELPLYRHIAQLAGNSDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGAESFRD AMRLGAEVYHTLKGVIKDKYGKDATNVGDEGGFAPNILENSEALELVKEAIDKAGYTEKI VIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALYQDFVRDYPVVSIEDPFDQDD WAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLA QENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDE ARFAGHNFRNPSVL
UniProt accession: P09104

Data

Human cerebellum stained with anti-NSE antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of neuronal cells.

FAQ & Publications

Frequently Asked Questions

What applications is the rabbit anti-NSE monoclonal antibody (ZR406) validated for?

This antibody is validated for Immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues.

How should the rabbit anti-NSE monoclonal antibody (ZR406) be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C, and for long-term storage, keep it at -20°C while avoiding freeze/thaw cycles.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.