| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | MyD88 (CT) |
| available sizes | 100 µg |
rabbit anti-MyD88 (CT) polyclonal antibody 7237
$445.00
Antibody summary
- Rabbit polyclonal to MyD88 (CT)
- Suitable for: ELISA,WB,IF,IP
- Isotype: IgG
- 100 µg
rabbit anti-MyD88 (CT) polyclonal antibody 7237
| antibody |
|---|
| Tested applications WB,IHC,IHC,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting: use at 1:500-1:1,000 dilution. Positive control: Whole cell lysate from Jurkat cells. |
| Immunogen Peptide corresponding to aa 279-296 of human MyD88. The sequence is identical to that of mouse MyD88. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze- thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens MYD88 Myeloid differentiation primary response protein MyD88 |
| Protein names Myeloid differentiation primary response protein MyD88 |
| Gene names MYD88 |
| Function Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response (PubMed:15361868, PubMed:18292575, PubMed:33718825, PubMed:37971847). Acts via IRAK1, IRAK2, IRF7 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (PubMed:15361868, PubMed:19506249, PubMed:24316379, PubMed:40638072). Increases IL-8 transcription (PubMed:9013863). Involved in IL-18-mediated signaling pathway. Activates IRF1 resulting in its rapid migration into the nucleus to mediate an efficient induction of IFN-beta, NOS2/INOS, and IL12A genes. Upon TLR8 activation by GU-rich single-stranded RNA (GU-rich RNA) derived from viruses such as SARS-CoV-2, SARS-CoV and HIV-1, induces IL1B release through NLRP3 inflammasome activation (PubMed:33718825). MyD88-mediated signaling in intestinal epithelial cells is crucial for maintenance of gut homeostasis and controls the expression of the antimicrobial lectin REG3G in the small intestine (By similarity) |
| Subcellular location Cytoplasm, Nucleus |
| Structure (Microbial infection) Interacts with human cytomegalovirus protein UL88; this interaction degrades MYD88 and reduces innate immune activation |
| Post-translational modification Ubiquitinated; undergoes 'Lys-63'-linked polyubiquitination. OTUD4 specifically hydrolyzes 'Lys-63'-linked polyubiquitinated MYD88 (PubMed:29395066). Deubiquitinated by USP3 that cleaves 'Lys-63'-linked ubiquitin chains leading to inhibition of MYD88-induced NF-kappa-B signaling (PubMed:37971847) (Microbial infection) Ubiquitinated by human herpesvirus 8 (KSHV) protein RTA/ORF50, leading to proteasomal degradation and suppression of TLR4 signaling pathway |
| Involvement in disease Immunodeficiency 68 An autosomal recessive primary immunodeficiency characterized by life-threatening, often recurrent, pyogenic bacterial infections, including invasive pneumococcal disease, beginning in infancy or early childhood. Macroglobulinemia, Waldenstrom, 1 A malignant B-cell neoplasm characterized by lymphoplasmacytic infiltration of the bone marrow and hypersecretion of monoclonal immunoglobulin M (IgM) protein. Clinical features are variable and include anemia, thrombocytopenia, hepatosplenomegaly, and lymphadenopathy. Many patients have asymptomatic or indolent disease. |
| Keywords 3D-structure, Alternative splicing, Antiviral defense, Cytoplasm, Disease variant, Immunity, Inflammatory response, Innate immunity, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Ubl conjugation |
| Sequence MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLE IRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQ QQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIR QLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFA LSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP |
| UniProt accession: Q99836 |
Data
 |
| KO Validation in HeLa Cells Loading: 10 µg of HeLa WT cell lysate or MyD88 KO cell lysate. Antibodies: MyD88 7237 (2 µg/mL) and beta-actin 3779 (1 µg/mL), 1 h incubation at RT in 5% NFDM/TBST.Secondary: Goat Anti-Rabbit IgG HRP conjugate at 1:10000 dilution. |
 |
| Western Blot Validation of MyD88 in human cell lines Loading: 15 µg of lysates per lane. Antibodies: 7237 (2 µg/mL) 1 h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.Predicted band size: 35 kDa |
 |
| Independent Antibody Validation (IAV) via Protein Expression Profile in Cell Lines Loading: 15 µg of lysates per lane. Antibodies: MyD88 2125 (2 µg/mL), MyD88 7237 (2 µg/mL), beta-actin (1 µg/mL), and GAPDH (0.02 µg/mL), 1 h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution. |
 |
| Independent Antibody Validation (IAV) via Protein Expression Profile in Human Tissues Loading: 15 µg of lysates per lane. Antibodies: MyD88 2125 (2 µg/mL), MyD88 7237 (2 µg/mL), beta-actin (1 µg/mL), and GAPDH (0.02 µg/mL), 1 h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution. |
 |
| Animal Species Reactivity Loading: Lysates/proteins at 15 µg per lane. Antibodies: 2125 (2 µg/mL) or 7237 (2 µg/mL). 1 h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution. |
 |
| Immunofluorescence Validation of MyD88 in Jurkat Cells Immunofluorescent analysis of 4% paraformaldehyde-fixed Jurkat cells labeling MyD88 with 7237 at 20 µg/mL, followed by goat anti-rabbit IgG secondary antibody at 1/500 dilution (red) and DAPI staining (blue). |
 |
| Immunofluorescence Validation of MyD88 in K562 Cells Immunofluorescent analysis of 4% paraformaldehyde-fixed K562 cells labeling MyD88 with 7237 at 20 µg/mL, followed by goat anti-rabbit IgG secondary antibody at 1/500 dilution (green) and DAPI staining (blue). |
 |
| KO Validation of MyD88 in Mouse T cells (Rahman et al., 2011) Splenocytes were isolated from a ;Myd88ΔT ;mouse in which MyD88 was specifically disrupted in T cells. T and B cells were FACS purified, and MyD88 expression was examined by Western blot with anti-MyD88 antibodies (7237). MyD88 expression was detected in Splenocytes and B cells, but not in T cells. |
 |
| KO Validation in CD45 - Thy1 + cells (Kim et al., 2017) The expression of Myd88 protein was analyzed in CD45 - Thy1 + intestinal mesenchymal cells and CD3 + intestinalT cells, by immunoblotting with anti-Myd88 antibodies (7237). MyD88 expression was not detected in knockout cells. |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-MyD88 (CT) polyclonal antibody 7237 been validated for?
The rabbit anti-MyD88 (CT) polyclonal antibody 7237 is suitable and has been validated for use in ELISA, Western blotting (WB), immunofluorescence (IF/ICC), immunoprecipitation (IP), and immunohistochemistry (IHC). Recommended dilutions for immunoblotting are 1:500 to 1:1,000.
How should the rabbit anti-MyD88 (CT) polyclonal antibody 7237 be stored to maintain its stability?
This antibody should be stored at -20°C and is stable for at least one year under these conditions. It is recommended to avoid multiple freeze-thaw cycles to preserve antibody integrity. The antibody is supplied in PBS buffer at pH 7.4, in liquid form, at a concentration of 1 mg/mL.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.