Skip to content

rabbit anti-myc tag polyclonal antibody 8059

(39 customer reviews)

Price range: $100.00 through $2,600.00

Antibody summary

  • Rabbit polyclonal to myc tag
  • Suitable for: ELISA
  • Reacts with: tagged fusion proteins
  • Isotype: IgG
  • 100 µg, 25 µg, 1 mg
SKU: 8059parent Categories: , Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

rabbit

isotype

IgG

clonality

polyclonal

concentration

1 mg/mL

applications

ELISA

reactivity

tagged fusion proteins

available sizes

1 mg, 100 µg, 25 µg

rabbit anti-myc tag polyclonal antibody 8059

antibody
Database link:
Sequence -Glu-Gln-Lys-Leu-Ile-Ser-Glu-Glu-Asp-Leu
Derived from c-myc 425-434 P01106
Tested applications
ELISA
Recommended dilutions
user optimized
Application Notes
This antibody reacts with EQKLISEEDL as determined by IEP and ELISA techniques. It is suitable for blotting, ELISA and IHC applications. Optimal working dilutions should be determined experimentally by the investigator.
Immunogen
Highly purified EQKLISEEDL conjugated with KLH
Size and concentration
25, 100, 1000µg and 1 mg/mL
Form
liquid
Storage Instructions
2-8°C
Storage buffer
PBS, pH 7.2, 0.09% NaN3
Purity
affinity purified
Clonality
polyclonal
Isotype
IgG
Compatible secondaries
goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863
goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control
Rabbit polyclonal - Isotype Control
target relevance
Homo sapiens MYC
Myc proto-oncogene protein
Protein names
Myc proto-oncogene protein
Alternative names
Class E basic helix-loop-helix protein 39, Proto-oncogene c-Myc, Transcription factor p64
Gene names
MYC
Function
Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3' (PubMed:24940000, PubMed:25956029). Activates the transcription of growth-related genes (PubMed:24940000, PubMed:25956029). Binds to the VEGFA promoter, promoting VEGFA production and subsequent sprouting angiogenesis (PubMed:24940000, PubMed:25956029). Regulator of somatic reprogramming, controls self-renewal of embryonic stem cells (By similarity). Functions with TAF6L to activate target gene expression through RNA polymerase II pause release (By similarity). Positively regulates transcription of HNRNPA1, HNRNPA2 and PTBP1 which in turn regulate splicing of pyruvate kinase PKM by binding repressively to sequences flanking PKM exon 9, inhibiting exon 9 inclusion and resulting in exon 10 inclusion and production of the PKM M2 isoform (PubMed:20010808)
Subcellular location
Nucleus, nucleoplasm, Nucleus, nucleolus, Nucleus, Cytoplasm, Chromosome
Structure
Efficient DNA binding requires dimerization with another bHLH protein. Binds DNA as a heterodimer with MAX (PubMed:9680483). Interacts with TAF1C and SPAG9. Interacts with PARP10. Interacts with KDM5A and KDM5B. Interacts (when phosphorylated at Thr-73 and Ser-77) with FBXW7 (PubMed:17558397, PubMed:25775507). Interacts with PIM2. Interacts with RIOX1. The heterodimer MYC:MAX interacts with ABI1; the interaction may enhance MYC:MAX transcriptional activity. Interacts with TRIM6 (By similarity). Interacts with NPM1; the binary complex is recruited to the promoter of MYC target genes and enhances their transcription (PubMed:25956029). Interacts with CIP2A; leading to the stabilization of MYC (PubMed:17632056). Interacts with NUP205 (PubMed:22719065). Interacts with HEATR1; the interaction is required for localization of MYC to the nucleolus (PubMed:38225354)
Post-translational modification
Phosphorylated by PRKDC (PubMed:1597196). Phosphorylation at Ser-344 by PIM2 leads to the stabilization of MYC (By similarity). Phosphorylation at Ser-77 by CDK2 prevents Ras-induced senescence (PubMed:19966300, PubMed:20713526). Phosphorylated at Ser-77 by DYRK2; this primes the protein for subsequent phosphorylation by GSK3B at Thr-73 (PubMed:22307329). Phosphorylation at Thr-73 and Ser-77 by GSK3 is required for ubiquitination and degradation by the proteasome (PubMed:15103331, PubMed:17558397, PubMed:8386367). Dephosphorylation at multiple sites by the PNUTS-PP1 complex promotes MYC stability by preventing ubiquitination by the SCF(FBXW7) complex (PubMed:30158517). Dephosphorylation at Ser-77 by protein phosphatase 2A (PPP2CA) promotes its degradation; interaction with PPP2CA is enhanced by AMBRA1 (PubMed:25438055, PubMed:25803737)
Ubiquitinated by the SCF(FBXW7) complex when phosphorylated at Thr-73 and Ser-77, leading to its degradation by the proteasome (PubMed:15103331, PubMed:17558397, PubMed:25775507, PubMed:30158517). In the nucleoplasm, ubiquitination is counteracted by USP28, which interacts with isoform 1 of FBXW7 (FBW7alpha), leading to its deubiquitination and preventing degradation (PubMed:17558397, PubMed:17873522). In the nucleolus, however, ubiquitination is not counteracted by USP28 but by USP36, due to the lack of interaction between isoform 3 of FBXW7 (FBW7gamma) and USP28, explaining the selective MYC degradation in the nucleolus (PubMed:17558397, PubMed:25775507). Also polyubiquitinated by the DCX(TRPC4AP) complex (PubMed:20551172, PubMed:29779948). Ubiquitinated by UBR5 when not forming a heterodimer with another bHLH protein, leading to its degradation: UBR5 recognizes and binds a degron that is only available upon heterodimer dissociation (PubMed:33208877, PubMed:37478862). Ubiquitinated by TRIM6 in a phosphorylation-independent manner (By similarity)
Involvement in disease
Burkitt lymphoma
A form of undifferentiated malignant lymphoma commonly manifested as a large osteolytic lesion in the jaw or as an abdominal mass.

Keywords
3D-structure, Acetylation, Activator, Alternative initiation, Alternative splicing, Chromosomal rearrangement, Chromosome, Cytoplasm, DNA-binding, Glycoprotein, Isopeptide bond, Nucleus, Phosphoprotein, Proteomics identification, Proto-oncogene, Reference proteome, Transcription, Transcription regulation, Ubl conjugation
Sequence
MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAP SEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTEL LGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPA RGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLS STESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAG GHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP RSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILS VQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
UniProt accession: P01106

Data

ICC/IF-image-rabbit-anti-myc tag-polyclonal-antibody-8059
Immunofluorescence cell staining rabbit anti-myc tag polyclonal antibody 8059 Immunofluorescent analysis of 4% paraformaldehyde (PFA)-fixed, permeabilized with 0.1% triton X-100 in CHO cells transfected with construct labeling with MYC antibody 8059 at 1:1000 dilution (1µg), followed by donkey-anti rabbit IgG (H&L), FITC conjugated antibody at 1:1000 dilution (1µg/mL) (green). Nucleus was counterstained with DAPI (blue).
ICC/IF-image-rabbit-anti-myc tag-polyclonal-antibody-8059
Immunofluorescence cell staining rabbit anti-myc tag polyclonal antibody 8059 Immunofluorescent analysis of 4% paraformaldehyde (PFA)-fixed, permeabilized with 0.1% triton X-100 in CHO cells transfected with 12-tags constructs (named as CHO-12 tags, top) and parental CHO cells (bottom) labeling with MYC antibody 8059 at 1:1000 dilution (1µg), followed by donkey-anti rabbit IgG (H&L), FITC conjugated antibody at 1:1000 dilution (1µg/mL) (green). Nucleus was counterstained with DAPI (blue).

FAQ & Publications

Frequently Asked Questions
What applications is the Rabbit Anti-Myc Tag Polyclonal Antibody 8059 validated for?
This antibody is suitable for ELISA, blotting, and immunohistochemistry (IHC) applications. Optimal working dilutions should be experimentally determined by the user.
How should the Rabbit Anti-Myc Tag Polyclonal Antibody 8059 be stored to maintain stability?
The antibody should be stored at 2-8°C in PBS buffer at pH 7.2 with 0.09% sodium azide to ensure stability.
Publications
pmid title authors citation
37717261 Structural features of thyroglobulin linked to protein trafficking. Cintia E Citterio, Kookjoo Kim, Bhavana Rajesh, Kevin Pena, Oliver Biggs Clarke, Peter Arvan Protein Sci 32:e4784
36581998 RNF31 represses cell progression and immune evasion via YAP/PD-L1 suppression in triple negative breast Cancer. Huijie Yang, Min Xue, Peng Su, Yan Zhou, Xin Li, Zhongbo Li, Yan Xia, Chenmiao Zhang, Mingxi Fu, Xiuxia Zheng, Guosheng Luo, Tian Wei, Xinxing Wang, Yinlu Ding, Jian Zhu, Ting Zhuang J Exp Clin Cancer Res 41:364
36497344 circRNF10 Regulates Tumorigenic Properties and Natural Killer Cell-Mediated Cytotoxicity against Breast Cancer through the miR-934/PTEN/PI3k-Akt Axis. Fei Liu, Yang Sang, Yang Zheng, Lina Gu, Lingjiao Meng, Ziyi Li, Yuyang Dong, Zishuan Wei, Cuizhi Geng, Meixiang Sang Cancers (Basel) 14:N/A
36375840 SMA-linked SMN mutants prevent phase separation properties and SMN interactions with FMRP family members. Olivier Binda, Franceline Juillard, Julia Novion Ducassou, Constance Kleijwegt, Geneviève Paris, Andréanne Didillon, Faouzi Baklouti, Armelle Corpet, Yohann Couté, Jocelyn Côté, Patrick Lomonte Life Sci Alliance 6:N/A
36313802 CasPlay provides a gRNA-barcoded CRISPR-based display platform for antibody repertoire profiling. Karl W Barber, Ellen Shrock, Stephen J Elledge Cell Rep Methods 2:100318

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
ELISA

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

39 reviews for rabbit anti-myc tag polyclonal antibody 8059

  1. verified user

    Review details
    Immunocytochemistry/ Immunofluorescence
    Sample type:Human Cell (human microglial cell line)
  2. verified user

    Review details
    Immunocytochemistry/ Immunofluorescence
    Sample type:Human Cell (HeLa)
  3. verified user

    Review details
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
    Sample type:Mouse Tissue sections (brain)
  4. verified user

    Review details
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
    Sample type:Zebrafish Tissue sections (bone)
  5. verified user

    Review details
    Immunocytochemistry/ Immunofluorescence
    Sample type:Human Cell (intestinal epithelial)
  6. verified user

    Review details
    Immunocytochemistry/ Immunofluorescence
    Sample type:Human Cell (HEK293FT and HT1080 cell lines)
  7. verified user

    Review details
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
    Sample type:Mouse Tissue sections (craniofacial)
  8. verified user

    Review details
    Immunocytochemistry
    Sample type:Human Cultured Cells (HELA)
  9. verified user

    Review details
    Western blot
    Sample type:Human Cell lysate – whole cell (HeLa)
  10. verified user

    Review details
    Immunohistochemistry (Frozen sections)
    Sample type:Mouse Tissue sections (Brain)
  11. verified user

    Review details
    Immunoprecipitation
    Sample type:Human Cell lysate – whole cell (CHO cell)
  12. verified user

    Review details
    Western blot
    Sample type:Human Cell lysate – whole cell (huh-7)
  13. verified user

    Review details
    Immunoprecipitation
    Sample type:Human Cell lysate – other (HELA)
  14. verified user

    Review details
    Immunoprecipitation
    Sample type:Human Cell lysate – whole cell (huh-7)
  15. verified user

    Review details
    Immunoprecipitation
    Sample type:Saccharomyces cerevisiae Cell lysate – whole cell (asynchronous population)
  16. verified user

    Review details
    Western blot
    Sample type:Human Cell lysate – whole cell (HEK cells)
  17. verified user

    Review details
    Immunocytochemistry/ Immunofluorescence
    Sample type:Sheep Cell (Primary Neuronal Cultures)
  18. verified user

    Review details
    Western blot
    Sample type:Tobacco Tissue lysate – whole (leaf)
  19. verified user

    Review details
    Western blot
    Sample type:Human Cell lysate – whole cell (CHO cell)
  20. verified user

    Review details
    Western blot
    Sample type:Human Cell lysate – whole cell (cancer cells)
  21. verified user

    Review details
    Western blot
    Sample type:Pichia pastoris Cell lysate – whole cell (Yeast)
  22. verified user

    Review details
    Immunoprecipitation
    Sample type:Human Cell lysate – whole cell (293 FT)
  23. verified user

    Review details
    Immunoprecipitation
    Sample type:Human Cell lysate – whole cell (293-T cells)
  24. verified user

    Review details
    Western blot
    Sample type:Mouse Cell lysate – whole cell (hepatocytes)
  25. verified user

    Review details
    Western blot
    Sample type:Human Cell lysate – whole cell (293T)
  26. verified user

    Review details
    Immunocytochemistry/ Immunofluorescence
    Sample type:African Green Monkey Cell (Cos7 transfected with pCMV-Nle-Myc)
  27. verified user

    Review details
    Immunoprecipitation
    Sample type:Human Cell lysate – whole cell (embryonic kidney)
  28. verified user

    Review details
    Immunocytochemistry/ Immunofluorescence, Mouse Cell (hippocampus
    Sample type:neurons)
  29. verified user

    Review details
    Western blot
    Sample type:African Green Monkey Cell lysate – whole cell (Cos7 transfected with pCMV-Nle-Myc)
  30. verified user

    Review details
    Immunoprecipitation
    Sample type:Saccharomyces cerevisiae Cell lysate – whole cell (whole cells)
  31. verified user

    Review details
    Western blot, Human Cell lysate – whole cell (Jurkat, K562
    Sample type:and HL-60 cells)
  32. verified user

    Review details
    Immunocytochemistry
    Sample type:Mouse Cell (mouse embryonic fibroblasts expressing myc-tagged)
  33. verified user

    Review details
    Western blot
    Sample type:Human Cell lysate – whole cell (293 Cells)
  34. verified user

    Review details
    Immunocytochemistry/ Immunofluorescence
    Sample type:Human Cell (Human Embryonic Kidney 293 cells)
  35. verified user

    Review details
    Immunocytochemistry/ Immunofluorescence
    Sample type:Human Cell (HeLa)
  36. verified user

    Review details
    Western blot
    Sample type:Human Cell lysate – whole cell (HEK293T)
  37. verified user

    Review details
    Immunocytochemistry/ Immunofluorescence
    Sample type:Arabidopsis thaliana Cell (whole mount root tissue)
  38. verified user

    Review details
    Immunoprecipitation
    Sample type:Human Cell lysate – whole cell (CANCER CELLS)
  39. verified user

    Review details
    Western blot
    Sample type:Human Cell lysate – whole cell (cancer cells)

Only logged in customers who have purchased this product may leave a review.