Skip to content

rabbit anti-mSurvivin (CT) polyclonal antibody 8314

$445.00

Antibody summary

  • Rabbit polyclonal to mSurvivin (CT)
  • Suitable for: ELISA,WB,IHC-P
  • Isotype: IgG
  • 100 µg
SKU: 8314parent Category: Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

rabbit

isotype

IgG

clonality

polyclonal

concentration

1 mg/mL

applications

ICC/IF, WB

reactivity

Survivin (mouse CT)

available sizes

100 µg

rabbit anti-mSurvivin (CT) polyclonal antibody 8314

antibody
Tested applications
WB,IHC,IHC,ELISA
Recommended dilutions
Immunoblotting: use at 1ug/mL.

Positive control: Mouse spleen cell lysate.

Immunohistochemistry: use at 10ug/mL.

These are recommended concentrations.

Enduser should determine optimal concentrations for their applications.
Immunogen
Synthetic peptide corresponding to aa 128-140 of mouse Survivin (accession no. BAA28266).
Size and concentration
100µg and lot specific
Form
liquid
Storage Instructions
This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles.
Storage buffer
PBS, pH 7.4.
Purity
peptide affinity purification
Clonality
polyclonal
Isotype
IgG
Compatible secondaries
goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863
goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control
Rabbit polyclonal - Isotype Control
target relevance
Mus musculus BIRC5
Baculoviral IAP repeat-containing protein 5
Protein names
Baculoviral IAP repeat-containing protein 5
Alternative names
Apoptosis inhibitor 4, Apoptosis inhibitor survivin, TIAP
Gene names
Birc5
Protein family
Belongs to the IAP family
Function
Multitasking protein that has dual roles in promoting cell proliferation and preventing apoptosis (PubMed:25778398). Component of a chromosome passage protein complex (CPC) which is essential for chromosome alignment and segregation during mitosis and cytokinesis (By similarity). Acts as an important regulator of the localization of this complex; directs CPC movement to different locations from the inner centromere during prometaphase to midbody during cytokinesis and participates in the organization of the center spindle by associating with polymerized microtubules (By similarity). Involved in the recruitment of CPC to centromeres during early mitosis via association with histone H3 phosphorylated at 'Thr-3' (H3pT3) during mitosis (By similarity). The complex with RAN plays a role in mitotic spindle formation by serving as a physical scaffold to help deliver the RAN effector molecule TPX2 to microtubules (By similarity). May counteract a default induction of apoptosis in G2/M phase (By similarity). The acetylated form represses STAT3 transactivation of target gene promoters (By similarity). May play a role in neoplasia. Inhibitor of CASP3 and CASP7 (By similarity). Essential for the maintenance of mitochondrial integrity and function (PubMed:25778398)
Subcellular location
Cytoplasm, Nucleus, Chromosome, Chromosome, centromere, Cytoplasm, cytoskeleton, spindle, Chromosome, centromere, kinetochore, Midbody
Structure
Monomer or homodimer. Exists as a homodimer in the apo state and as a monomer in the CPC-bound state. The monomer protects cells against apoptosis more efficiently than the dimer. Only the dimeric form is capable of enhancing tubulin stability in cells. When phosphorylated, interacts with LAMTOR5/HBXIP; the resulting complex binds pro-CASP9, as well as active CASP9, but much less efficiently. Component of the chromosomal passenger complex (CPC) composed of at least BIRC5/survivin, CDCA8/borealin, INCENP, AURKB or AURKC; in the complex forms a triple-helix bundle-based subcomplex with INCENP and CDCA8. Interacts with JTB. Interacts (via BIR domain) with histone H3 phosphorylated at 'Thr-3' (H3pT3). Interacts with EVI5. Interacts with GTP-bound RAN in both the S and M phases of the cell cycle. Interacts with USP9X. Interacts with tubulin. Interacts with BIRC2/c-IAP1. The acetylated form at Lys-129 interacts with STAT3. The monomeric form deacetylated at Lys-129 interacts with XPO1/CRM1. The monomeric form interacts with XIAP/BIRC4. Both the dimeric and monomeric form can interact with DIABLO/SMAC. Interacts with BIRC6/bruce. Interacts with FBXL7; this interaction facilitates the polyubiquitination and subsequent proteasomal degradation of BIRC5 by the SCF(FBXL7) E3 ubiquitin-protein ligase complex (By similarity)
Post-translational modification
Ubiquitinated by the Cul9-RING ubiquitin-protein ligase complex, leading to its degradation. Ubiquitination is required for centrosomal targeting. Deubiquitinated by USP35 or USP38; leading to stabilization
Acetylation at Lys-129 results in its homodimerization, while deacetylation promotes the formation of monomers which heterodimerize with XPO1/CRM1 which facilitates its nuclear export. The acetylated form represses STAT3 transactivation. The dynamic equilibrium between its acetylation and deacetylation at Lys-129 determines its interaction with XPO1/CRM1, its subsequent subcellular localization, and its ability to inhibit STAT3 transactivation
In vitro phosphorylation at Thr-117 by AURKB prevents interaction with INCENP and localization to mitotic chromosomes. Phosphorylation at Thr-48 by CK2 is critical for its mitotic and anti-apoptotic activities. Phosphorylation at Thr-34 by CDK15 is critical for its anti-apoptotic activity
Keywords
3D-structure, Acetylation, Alternative splicing, Apoptosis, Cell cycle, Cell division, Centromere, Chromosome, Chromosome partition, Cytoplasm, Cytoskeleton, Kinetochore, Metal-binding, Microtubule, Mitosis, Nucleus, Phosphoprotein, Protease inhibitor, Reference proteome, Repressor, Thiol protease inhibitor, Transcription, Transcription regulation, Ubl conjugation, Zinc
Sequence
MGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFC FKELEGWEPDDNPIEEHRKHSPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIAKETNNK QKEFEETAKTTRQSIEQLAA
UniProt accession: O70201

Data

benchmark-antibodies_anti-survivin_mouse_ct_antibody_8314_1.jpg
Western blot analysis of survivin in mouse spleen tissue lysate with survivin antibody at 1 µg/mL.
benchmark-antibodies_anti-survivin_mouse_ct_antibody_8314_2.jpg
Immunohistochemistry of Survivin in mouse spleen cells with Survivin antibody at 10 ug/mL.

FAQ & Publications

Frequently Asked Questions
What species does the rabbit anti-mSurvivin (CT) polyclonal antibody 8314 specifically recognize?
This antibody specifically reacts with mouse Survivin (CT) protein.
Which applications has the rabbit anti-mSurvivin (CT) polyclonal antibody 8314 been validated for?
It is suitable and tested for Western blot (WB), immunohistochemistry on paraffin-embedded tissues (IHC-P), and ELISA applications.
How should the rabbit anti-mSurvivin (CT) polyclonal antibody 8314 be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. Multiple freeze-thaw cycles should be avoided.
What is the recommended dilution for using this antibody in immunohistochemistry?
For immunohistochemistry, a recommended working concentration is 10 µg/mL, though users should optimize concentrations for their specific applications.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
Western blot
IHC
ICC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.