| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | MAP-1 |
| available sizes | 100 µg |
rabbit anti-MAP-1 polyclonal antibody 6884
$376.00
Antibody summary
- Rabbit polyclonal to MAP-1
- Suitable for: ELISA
- Isotype: Whole IgG
- 100 µg
rabbit anti-MAP-1 polyclonal antibody 6884
| antibody |
|---|
| Tested applications ELISA |
| Recommended dilutions Immunoblotting: use at 1:500-1:1,000 dilution. A band of approx. 39kDa is detected. Positive control: Heart or brain tissue lysate. These are recommended concentrations. Enduser should determine optimal concentrations for their applications. |
| Immunogen Synthetic peptide corresponding to aa 337-351 of human MAP-1. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens MOAP1 Modulator of apoptosis 1 |
| Protein names Modulator of apoptosis 1 |
| Alternative names Paraneoplastic antigen Ma4 |
| Gene names MOAP1 |
| Protein family Belongs to the PNMA family |
| Function Retrotransposon-derived protein that forms virion-like capsids (By similarity). Acts as an effector of BAX during apoptosis: enriched at outer mitochondria membrane and associates with BAX upon induction of apoptosis, facilitating BAX-dependent mitochondrial outer membrane permeabilization and apoptosis (PubMed:11060313, PubMed:16199525). Required for death receptor-dependent apoptosis (PubMed:11060313). When associated with RASSF1, promotes BAX conformational change and translocation to mitochondrial membranes in response to TNF and TNFSF10 stimulation (PubMed:15949439). Also promotes autophagy: promotes phagophore closure via association with ATG8 proteins (PubMed:33783314). Acts as an inhibitor of the NFE2L2/NRF2 pathway via interaction with SQSTM1: interaction promotes dissociation of SQSTM1 inclusion bodies that sequester KEAP1, relieving inactivation of the BCR(KEAP1) complex (PubMed:33393215) |
| Subcellular location Cytoplasm, cytosol, Mitochondrion outer membrane, Extracellular vesicle membrane |
| Structure Homodimer (PubMed:15949439). Under normal circumstances, held in an inactive conformation by an intramolecular interaction (PubMed:15949439). Interacts with BAX (PubMed:11060313, PubMed:16199525). Binding to RASSF1 isoform A (RASSF1A) relieves this inhibitory interaction and allows further binding to BAX (PubMed:15949439). Also binds to BCL2 and BCLX (PubMed:11060313). Recruited to the TNFRSF1A and TNFRSF10A complexes in response to their respective cognate ligand, after internalization (PubMed:15949439). Interacts with TRIM39 (PubMed:19100260). Interacts with RASSF6 (By similarity). Interacts with ATG8 proteins MAP1LC3A, MAP1LC3B and MAP1LC3C (PubMed:33783314). Does not interact with ATG8 proteins GABARAPL1, GABARAPL2 and GABARAP (PubMed:33783314). Interacts with SQSTM1; promoting dissociation of SQSTM1 inclusion bodies that sequester KEAP1 (PubMed:33393215) |
| Post-translational modification Ubiquitinated and degraded during mitotic exit by APC/C-Cdh1, this modification is inhibited by TRIM39 |
| Keywords 3D-structure, Apoptosis, Autophagy, Cytoplasm, Membrane, Mitochondrion, Mitochondrion outer membrane, Proteomics identification, Reference proteome, Ubl conjugation |
| Sequence MTLRLLEDWCRGMDMNPRKALLIAGISQSCSVAEIEEALQAGLAPLGEYRLLGRMFRRDE NRKVALVGLTAETSHALVPKEIPGKGGIWRVIFKPPDPDNTFLSRLNEFLAGEGMTVGEL SRALGHENGSLDPEQGMIPEMWAPMLAQALEALQPALQCLKYKKLRVFSGRESPEPGEEE FGRWMFHTTQMIKAWQVPDVEKRRRLLESLRGPALDVIRVLKINNPLITVDECLQALEEV FGVTDNPRELQVKYLTTYQKDEEKLSAYVLRLEPLLQKLVQRGAIERDAVNQARLDQVIA GAVHKTIRRELNLPEDGPAPGFLQLLVLIKDYEAAEEEEALLQAILEGNFT |
| UniProt accession: Q96BY2 |
Data
 |
| Effect of gamma irradiation and IFN-beta on IP6K2 protein levels. |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-MAP-1 polyclonal antibody 6884 been validated for?
This antibody has been tested and validated for ELISA, immunocytochemistry/immunofluorescence (ICC/IF), and Western blotting (WB). For immunoblotting, it is recommended to use the antibody at a dilution of 1:500-1:1,000, where it detects a band of approximately 39 kDa.
How should the rabbit anti-MAP-1 polyclonal antibody 6884 be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the immunogen used to generate the rabbit anti-MAP-1 polyclonal antibody 6884?
The immunogen is a synthetic peptide corresponding to amino acids 337-351 of human MAP-1.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| ELISA |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.