| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG |
| clonality | monoclonal |
| concentration | concentrate, predilute |
| applications | IHC |
| reactivity | human |
| available size | 0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted |
rabbit anti-Mammaglobin monoclonal antibody (ZR363) 6245
Price range: $160.00 through $528.00
Antibody summary
- Rabbit monoclonal to Mammaglobin
- Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
- Reacts with: Human
- Isotype:IgG
- Control: Normal or neoplastic breast tissue
- Visualization: Cytoplasmic
- 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
rabbit anti-Mammaglobin monoclonal antibody ZR363 6245
| target relevance |
|---|
| Homo sapiens SCGB2A2 Mammaglobin-A |
| Protein names Mammaglobin-A |
| Alternative names Mammaglobin-1, Secretoglobin family 2A member 2 |
| Gene names SCGB2A2 |
| Protein family Belongs to the secretoglobin family. Lipophilin subfamily |
| Subcellular location Secreted |
| Keywords Alternative splicing, Glycoprotein, Proteomics identification, Reference proteome, Secreted, Signal |
| Sequence MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAID ELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF |
| UniProt accession: Q13296 |
Data
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-Mammaglobin monoclonal antibody (ZR363) validated for?
This antibody is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues.
How should the rabbit anti-Mammaglobin monoclonal antibody be stored to maintain stability?
For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C, and freeze/thaw cycles should be avoided.
Which species does the rabbit anti-Mammaglobin monoclonal antibody specifically react with?
This antibody specifically reacts with human Mammaglobin protein.
What type of control tissue is recommended when using this antibody in immunohistochemistry?
Normal or neoplastic breast tissue is recommended as a positive control for immunohistochemical staining with this antibody.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.

















Reviews
There are no reviews yet.