| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | Mouse IgG1/κ /Rabbit IgG |
| clonality | monoclonal |
| concentration | concentrate, predilute |
| applications | IHC |
| reactivity | human |
| available size | 0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted |
rabbit anti-Mammaglobin Cocktail monoclonal antibody (304-1A5 & 31-A5) 6248
Price range: $160.00 through $528.00
Antibody summary
- Rabbit monoclonal to Mammaglobin Cocktail
- Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
- Reacts with: Human
- Isotype:Mouse IgG1/κ /Rabbit IgG
- Control: Normal or neoplastic breast tissue
- Visualization: Cytoplasmic
- 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
rabbit anti-Mammaglobin Cocktail monoclonal antibody 304-1A5 & 31-A5 6248
| target relevance |
|---|
| Homo sapiens SCGB2A2 Mammaglobin-A |
| Protein names Mammaglobin-A |
| Alternative names Mammaglobin-1, Secretoglobin family 2A member 2 |
| Gene names SCGB2A2 |
| Protein family Belongs to the secretoglobin family. Lipophilin subfamily |
| Subcellular location Secreted |
| Keywords Alternative splicing, Glycoprotein, Proteomics identification, Reference proteome, Secreted, Signal |
| Sequence MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAID ELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF |
| UniProt accession: Q13296 |
Data
![]() |
| Human breast carcinoma stained with anti-Mammaglobin antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of tumor glands. |
FAQ & Publications
Frequently Asked Questions
What is the recommended application and dilution for the rabbit anti-Mammaglobin Cocktail monoclonal antibody (304-1A5 & 31-A5)?
This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissue samples. The recommended dilution for the concentrated antibody is between 1:50 and 1:100.
How should the rabbit anti-Mammaglobin Cocktail monoclonal antibody be stored to maintain stability?
For short-term storage, keep the antibody at 2-8°C. For longer-term preservation, store at -20°C and avoid multiple freeze/thaw cycles to maintain antibody stability.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.

















Reviews
There are no reviews yet.