Immunohistochemistry (IHC) : Human breast carcinoma stained with anti-Mammaglobin antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of tumor cells..

rabbit anti-Mammaglobin monoclonal antibody (31-A5) 6247

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to Mammaglobin
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Breast carcinoma
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6247parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Breast Pathology, Mammaglobin

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-Mammaglobin monoclonal antibody 31-A5 6247

antibody
Database link: human O14601
Tested applications IHC
Recommended dilutions Concentrated 1:100
Application Notes Positive control: Breast carcinoma
Immunogen Recombinant full-length protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens SCGB2A2 Mammaglobin-A
Protein names Mammaglobin-A
Alternative names Mammaglobin-1, Secretoglobin family 2A member 2
Gene names SCGB2A2
Protein family Belongs to the secretoglobin family. Lipophilin subfamily
Subcellular location Secreted
Keywords Alternative splicing, Glycoprotein, Proteomics identification, Reference proteome, Secreted, Signal
Sequence MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAID ELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF
UniProt accession: Q13296

Data

Human breast carcinoma stained with anti-Mammaglobin antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of tumor cells..

FAQ & Publications

Frequently Asked Questions

What applications is the rabbit anti-Mammaglobin monoclonal antibody (31-A5) validated for?

This antibody is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

How should the rabbit anti-Mammaglobin monoclonal antibody be stored to maintain stability?

Store the antibody at 2-8°C for short term use and at -20°C for longer term storage, avoiding freeze/thaw cycles to preserve antibody integrity.

What species does this Mammaglobin antibody react with?

The antibody specifically reacts with human Mammaglobin, making it suitable for studies involving human tissues.

What are the available concentrations and formats for this antibody?

The antibody is available in concentrated forms of 0.1 mL, 0.5 mL, and 1.0 mL, as well as a 7 mL prediluted solution.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.