| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG |
| clonality | monoclonal |
| concentration | concentrate, predilute |
| applications | IHC |
| reactivity | human |
| available size | 0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted |
rabbit anti-INSM1 monoclonal antibody (ZR395) 6232
Price range: $160.00 through $528.00
Antibody summary
- Rabbit monoclonal to INSM1
- Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
- Reacts with: Human
- Isotype:IgG
- Control: Neuroendocrine tumor/pancreas
- Visualization: Nucleus
- 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
rabbit anti-INSM1 monoclonal antibody ZR395 6232
| antibody |
|---|
| Database link: human O14601 |
| Tested applications IHC |
| Recommended dilutions Concentrated 1:100-200 |
| Application Notes Positive control: Neuroendocrine tumor/pancreas |
| Immunogen Recombinant fragment (around aa1-300) corresponding to the N-terminus of human INSM1 |
| Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated |
| Form liquid |
| Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles. |
| Purity affinity purified |
| Clonality monoclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Danio rerio INSM1A Insulinoma-associated protein 1a |
| Protein names Insulinoma-associated protein 1a |
| Alternative names Insulinoma-associated 1-like protein a, Zinc finger protein IA-1a |
| Gene names insm1a |
| Protein family Belongs to the INSM1 family |
| Function May act as a transcriptional regulator. May play a role in neurogenesis and neuroendocrine cell differentiation during embryonic development (By similarity) |
| Subcellular location Nucleus |
| Keywords Developmental protein, Differentiation, DNA-binding, Metal-binding, Neurogenesis, Nucleus, Reference proteome, Repeat, Transcription, Transcription regulation, Zinc, Zinc-finger |
| Sequence MPRGFLVKRNKKATPVSYRVRSEEDEQGAFVAQDVPCARRPVSPVQFGNPETVYRAMYSP TRPVSREHERACLERRFNLGSPISAESFPAAPNCSDQAPVDLKIGTSNSNRTGTTVTTKR PASDTERKGKPASKKAKAMRKLQFEDEMTTSPVLGLKIKEGPVEQKPRSQCASGDKPLGE FVCQLCREAYADPFSLAQHKCSRIVRIEYRCPECDKLFSCPANLASHRRWHKPKQSAESN KTPAPEKEETSSDRDTPSPGLSESGSEDGLYDCQHCGKKFKRQAYLKKHVTAHHDAPEKP QSHAPLNLSASECHLCPVCGENFPSRMSQERHIRLQHSAQVYPCKYCPAMFYSSPGLTRH INKCHPSENRQVILLQMPVRPAC |
| UniProt accession: Q6P0F9 |
Data
![]() |
| Formalin-fixed, paraffin-embedded human pancreas stained with anti-INSM1 antibody using peroxidase-conjugate and DAB chromogen Note the nuclear staining of islet cells |
FAQ & Publications
Frequently Asked Questions
What is the recommended application and dilution for the rabbit anti-INSM1 monoclonal antibody (ZR395)?
This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues. The recommended dilution for the concentrated form is 1:100-200.
How should the rabbit anti-INSM1 monoclonal antibody be stored to maintain its stability?
For short-term storage, keep the antibody at 2-8°C. For longer-term preservation, store it at -20°C and avoid repeated freeze/thaw cycles to maintain antibody integrity.
Which species does the rabbit anti-INSM1 monoclonal antibody specifically react with, and what is its host and clonality?
This monoclonal antibody is reactive with human INSM1 protein. It is produced in rabbit as the host species and is monoclonal in clonality.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.

















Reviews
There are no reviews yet.