| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Interleukin-21 (IL-21) (IN) |
| available sizes | 100 µg |
rabbit anti-IL-21 (IN) polyclonal antibody 6228
$469.00
Antibody summary
- Rabbit polyclonal to IL-21 (IN)
- Suitable for: ELISA,WB,ICC
- Isotype: Whole IgG
- 100 µg
rabbit anti-IL-21 (IN) polyclonal antibody 6228
| antibody |
|---|
| Tested applications WB,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting: use at 0.5-1 ug/mL. In immunoblots, a band of 18 kD is detected. Positive control: HL60 or THP-1 cell lysates. |
| Immunogen Peptide corresponding to aa 121-135 of human IL-21 precursor. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze- thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens IL21 Interleukin-21 |
| Protein names Interleukin-21 |
| Alternative names Za11 |
| Gene names IL21 |
| Protein family Belongs to the IL-15/IL-21 family |
| Function Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG(1) and IgG(3) in B-cells (By similarity). Implicated in the generation and maintenance of T follicular helper (Tfh) cells and the formation of germinal-centers. Together with IL6, control the early generation of Tfh cells and are critical for an effective antibody response to acute viral infection (By similarity). May play a role in proliferation and maturation of natural killer (NK) cells in synergy with IL15. May regulate proliferation of mature B- and T-cells in response to activating stimuli. In synergy with IL15 and IL18 stimulates interferon gamma production in T-cells and NK cells (PubMed:11081504, PubMed:15178704). During T-cell mediated immune response may inhibit dendritic cells (DC) activation and maturation (By similarity) |
| Subcellular location Secreted |
| Involvement in disease Immunodeficiency, common variable, 11 A primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B-cells is usually in the normal range, but can be low. |
| Keywords 3D-structure, Alternative splicing, Cytokine, Disease variant, Disulfide bond, Glycoprotein, Proteomics identification, Reference proteome, Secreted, Signal |
| Sequence MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEF LPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRL TCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS |
| UniProt accession: Q9HBE4 |
Data
 |
| Western Blot Validation in Human, Mouse and Rat Cell Lines Loading: 15 µg of lysates per lane. Antibodies: IL-21 6228, (1 µg/mL), 1h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution. |
 |
| Independent Antibody Validation (IAV) via Protein Expression Profile in Cell Lines Loading: 15 µg of lysates per lane. Antibodies: IL-21 6228 (1 µg/mL), IL-21 2463 (5 µg/mL), beta-actin (5 µg/mL) and beta-actin (1 µg/mL), 1h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution. |
 |
| Western Blot Validation in Human HL-60 Cell Lysate Loading: 15 µg of lysates per lane. Antibodies: IL-21 6228 (1 µg/mL), 1h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.(A) Absence of blocking peptide(B) Presence of blocking peptide. |
 |
| Immunocytochemistry Validation of IL-21 in K562 Cells Immunocytochemical analysis of K562 cells using anti-IL-21 antibody (6228) at 2 µg/mL. Cells was fixed with formaldehyde and blocked with 10% serum for 1 h at RT; antigen retrieval was by heat mediation with a citrate buffer (pH6). Samples were incubated with primary antibody overnight at 4 C. A goat anti-rabbit IgG H&L (HRP) at 1/250 was used as secondary. Counter stained with Hematoxylin. |
 |
| Induced Expression Validation of IL-21 expresssion in patients with Crohn'sDisease (Monteleone et al, 2416) Enhanced IL-21 was observed in involved but not uninvolvedCD, and was not associated with any CD phenotype, such as fibrostenosing disease. IL-21 expression was detected by anti-IL-21 antibodies (6228). |
 |
| Regulation of IL-21 expresssion in duodenal biopsies of two patients with active Celiac disease (ACD) (Sarra et al., 2412) (b) shows IL-21 expression levels treated with dimethyl sulfoxide (DMSO) or wortmannin (WRT). (c) shows IL-21 expression levels with the inhibition of IL-15 antibody (aIL-15). IgG isotype was used as a control.Both WB show IL-21 expression decreased with the treatment with WRT or the inhibition of IL-15 antibody. |
 |
| Induced Expression Validation of IL-21 expresssion in patients with Helicobacter Pylori (Hp) (Caruso et al., 2416) (A) shows IL-21 expression levels from biopsies of patients with Hp infection and without Hp infection (n=3).(C) shows IL-21 expression levels in CD3+LPMC cells from Hp-positive and Hp-negative patients (n=3).Both WB show IL-21 expression increased in patients with Hp infection. |
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-IL-21 (IN) polyclonal antibody 6228 validated for?
The antibody is validated for use in ELISA, Western blotting (WB), and immunocytochemistry/immunofluorescence (ICC/IF) applications.
How should the rabbit anti-IL-21 (IN) polyclonal antibody 6228 be stored to maintain its stability?
This antibody should be stored at -20°C and is stable for at least one year under these conditions. It is recommended to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the immunogen used to generate the rabbit anti-IL-21 (IN) polyclonal antibody 6228?
The immunogen is a peptide corresponding to amino acids 121-135 of the human IL-21 precursor protein.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.