Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human glioma stained with anti-IHD1 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear and cytoplasmic staining of infiltrating glioma cells whereas normal glial cells are negative

rabbit anti-IDH1 (R132H) monoclonal antibody (ZR7) 6220

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to IDH1 (R132H)
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Infiltrating glioma
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6220parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, IDH1 (R132H), monoclonal, Neuropathology/Endocrine

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-IDH1 (R132H) monoclonal antibody ZR7 6220

antibody
Database link: human O75874
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Infiltrating glioma
Immunogen Recombinant fragment of human IDH1 (exact sequence is proprietary)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens IDH1 Isocitrate dehydrogenase [NADP] cytoplasmic
Protein names Isocitrate dehydrogenase [NADP] cytoplasmic
Alternative names Cytosolic NADP-isocitrate dehydrogenase, IDPc, NADP(+)-specific ICDH, Oxalosuccinate decarboxylase
Gene names IDH1
Protein family Belongs to the isocitrate and isopropylmalate dehydrogenases family
Function Catalyzes the NADP(+)-dependent oxidative decarboxylation of isocitrate (D-threo-isocitrate) to 2-ketoglutarate (2-oxoglutarate), which is required by other enzymes such as the phytanoyl-CoA dioxygenase (PubMed:10521434, PubMed:19935646). Plays a critical role in the generation of NADPH, an important cofactor in many biosynthesis pathways (PubMed:10521434). May act as a corneal epithelial crystallin and may be involved in maintaining corneal epithelial transparency (By similarity)
Catalytic activity D-threo-isocitrate + NADP(+) = 2-oxoglutarate + CO2 + NADPH
Subcellular location Cytoplasm, cytosol, Peroxisome
Structure Homodimer
Post-translational modification Acetylation at Lys-374 dramatically reduces catalytic activity
Involvement in disease Glioma Gliomas are benign or malignant central nervous system neoplasms derived from glial cells. They comprise astrocytomas and glioblastoma multiforme that are derived from astrocytes, oligodendrogliomas derived from oligodendrocytes and ependymomas derived from ependymocytes.
Keywords 3D-structure, Acetylation, Cytoplasm, Direct protein sequencing, Glyoxylate bypass, Magnesium, Manganese, Metal-binding, NADP, Oxidoreductase, Peroxisome, Phosphoprotein, Proteomics identification, Reference proteome, Tricarboxylic acid cycle
Sequence MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDA AEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL VSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAM GMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFE AQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALE EVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL
UniProt accession: O75874

Data

Formalin-fixed, paraffin-embedded human glioma stained with anti-IHD1 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear and cytoplasmic staining of infiltrating glioma cells whereas normal glial cells are negative

FAQ & Publications

Frequently Asked Questions

What species is the rabbit anti-IDH1 (R132H) monoclonal antibody (ZR7) reactive with?

This antibody is reactive with human species only.

What is the recommended application and dilution for using this antibody in immunohistochemistry?

The antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues, with a recommended dilution of 1:100-200 when using the concentrated form.

How should the rabbit anti-IDH1 (R132H) antibody be stored to maintain stability?

Store the antibody at 2-8°C for short-term use and at -20°C for long-term storage, while avoiding repeated freeze/thaw cycles.

What is the host and clonality of this anti-IDH1 (R132H) antibody?

The antibody is a rabbit monoclonal IgG.

What type of positive control is recommended when using this antibody in immunohistochemistry?

An infiltrating glioma sample is recommended as a positive control for this antibody.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.