rabbit anti-HO1 polyclonal antibody 1028

Price range: $100.00 through $2,600.00

Antibody summary

Rabbit polyclonal to HO-1 (Heme oxygenase-1)
Suitable for: IP
Reacts with: Hu
Isotype: IgG
100 µL, 10 µl

available sizes

Clear

SKU: 1028parent Categories: antibody, oxidative stress Tag: HO-1

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	rabbit
isotype	IgG
clonality	polyclonal
concentration	1 mg/mL
applications	IP
reactivity	human
available sizes	10 µL, 100 µL

rabbit anti- ho1 polyclonal antibody 1028

antibody
Database link: human P09601
Tested applications IP
Recommended dilutions Immunoprecipitation (IP) 6 µg/mg lysate
Immunogen Between 1 and 50
Size and concentration 100µL and 1 mg/mL
Form liquid
Storage Instructions Store at 2-8°C. Expires 1 year from date of receipt.
Storage buffer Tris-citrate/phosphate buffer, pH 7 to 8 containing 0.09% Sodium Azide
Purity affinity purified
Clonality polyclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens HMOX1 Heme oxygenase 1
Protein names Heme oxygenase 1
Gene names HMOX1
Protein family Belongs to the heme oxygenase family
Function Catalyzes the oxidative cleavage of heme at the alpha-methene bridge carbon, released as carbon monoxide (CO), to generate biliverdin IXalpha, while releasing the central heme iron chelate as ferrous iron (PubMed:11121422, PubMed:19556236, PubMed:7703255). Affords protection against programmed cell death and this cytoprotective effect relies on its ability to catabolize free heme and prevent it from sensitizing cells to undergo apoptosis (PubMed:20055707)
Catalytic activity heme b + 3 reduced [NADPH--hemoprotein reductase] + 3 O2 = biliverdin IXalpha + CO + Fe(2+) + 3 oxidized [NADPH--hemoprotein reductase] + 3 H2O + H(+)
Subcellular location Endoplasmic reticulum membrane
Structure Homodimer and higher order homooligomer (PubMed:19556236). Oligomerization is crucial for its stability and function in the endoplasmic reticulum (PubMed:19556236). Interacts with FLVCR2; this interaction is potentiated in the presence of heme
Post-translational modification A soluble form arises by proteolytic removal of the membrane anchor
Involvement in disease Heme oxygenase 1 deficiency A disease characterized by impaired stress hematopoiesis, resulting in marked erythrocyte fragmentation and intravascular hemolysis, coagulation abnormalities, endothelial damage, and iron deposition in renal and hepatic tissues. Clinical features include persistent hemolytic anemia, asplenia, nephritis, generalized erythematous rash, growth retardation and hepatomegaly.
Keywords 3D-structure, Apoptosis, Endoplasmic reticulum, Heme, Host-virus interaction, Iron, Membrane, Metal-binding, Oxidoreductase, Phosphoprotein, Proteomics identification, Reference proteome, Transmembrane, Transmembrane helix
Sequence MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVA LEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHE VGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQ LYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRA SNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM
UniProt accession: P09601

Data

WB-image-anti-HO-1 (Heme oxygenase-1) antibody-1028_1

Detection of human HO-1 by western blot of immunoprecipitates. Samples: Whole cell lysate (1 mg for IP, 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-HO-1 antibody #1028 used for IP at 6 µg/mg lysate. HO-1 was also immunoprecipitated by rabbit anti-HO-1 antibody, which recognizes a downstream epitope. For blotting immunoprecipitated HO-1 was used at 1 µg/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-HO1 polyclonal antibody 1028 specifically react with?

This antibody specifically reacts with human HO-1 protein.

What are the recommended storage conditions and shelf life for this antibody?

The antibody should be stored at 2-8°C and is stable for up to one year from the date of receipt.

For which application has the rabbit anti-HO1 polyclonal antibody 1028 been validated, and what is the recommended dilution?

This antibody has been validated for immunoprecipitation (IP) with a recommended dilution of 6 µg per mg of lysate.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.