rabbit anti-HO1 polyclonal antibody 1008

Price range: $150.00 through $2,600.00

Antibody summary

Rabbit polyclonal to HO-1 (Heme oxygenase-1)
Suitable for: WB,IP
Reacts with: Hu
Isotype: IgG
100 µg, 25 µg

available sizes

Clear

SKU: 1008parent Categories: antibody, oxidative stress Tag: HO-1

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	rabbit
isotype	IgG
clonality	polyclonal
concentration	1 mg/mL
applications	IP, WB
reactivity	human
available sizes	100 µg, 25 µg

rabbit anti- ho1 polyclonal antibody 1008

antibody
Database link: human P09601
Tested applications WB,IP
Recommended dilutions Western Blot 1:2,000 - 1:10,000, Immunoprecipitation 2 - 10 µg/mg lysate
Immunogen The epitope recognized by A303-662A maps to a region between residue 238 and 288 of human Heme Oxygenase (decycling) 1 using the numbering given in entry NP_002124.1 (GeneID 3162).
Size and concentration 100µL and 1 mg/mL
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Storage buffer Tris-citrate/phosphate buffer, pH 7 to 8 containing 0.09% Sodium Azide
Purity affinity purified
Clonality polyclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens HMOX1 Heme oxygenase 1
Protein names Heme oxygenase 1
Gene names HMOX1
Protein family Belongs to the heme oxygenase family
Function Catalyzes the oxidative cleavage of heme at the alpha-methene bridge carbon, released as carbon monoxide (CO), to generate biliverdin IXalpha, while releasing the central heme iron chelate as ferrous iron (PubMed:11121422, PubMed:19556236, PubMed:7703255). Affords protection against programmed cell death and this cytoprotective effect relies on its ability to catabolize free heme and prevent it from sensitizing cells to undergo apoptosis (PubMed:20055707)
Catalytic activity heme b + 3 reduced [NADPH--hemoprotein reductase] + 3 O2 = biliverdin IXalpha + CO + Fe(2+) + 3 oxidized [NADPH--hemoprotein reductase] + 3 H2O + H(+)
Subcellular location Endoplasmic reticulum membrane
Structure Homodimer and higher order homooligomer (PubMed:19556236). Oligomerization is crucial for its stability and function in the endoplasmic reticulum (PubMed:19556236). Interacts with FLVCR2; this interaction is potentiated in the presence of heme
Post-translational modification A soluble form arises by proteolytic removal of the membrane anchor
Involvement in disease Heme oxygenase 1 deficiency A disease characterized by impaired stress hematopoiesis, resulting in marked erythrocyte fragmentation and intravascular hemolysis, coagulation abnormalities, endothelial damage, and iron deposition in renal and hepatic tissues. Clinical features include persistent hemolytic anemia, asplenia, nephritis, generalized erythematous rash, growth retardation and hepatomegaly.
Keywords 3D-structure, Apoptosis, Endoplasmic reticulum, Heme, Host-virus interaction, Iron, Membrane, Metal-binding, Oxidoreductase, Phosphoprotein, Proteomics identification, Reference proteome, Transmembrane, Transmembrane helix
Sequence MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVA LEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHE VGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQ LYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRA SNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM
UniProt accession: P09601

Data

WB-image-anti-HO-1 (Heme oxygenase-1) antibody-1008_1

Detection of human HO-1 by western blot and immunoprecipitation. Samples: Whole cell lysate from HeLa (15 and 50 µg for WB; 1 mg for IP, 20% of IP loaded), HEK293T (T; 50 µg) and Jurkat (J; 50 µg) cells. Antibodies: Affinity purified rabbit anti-HO-1 antibody #1008 used for WB at 0.1 µg/ml (A) and 1 µg/ml (B) and used for IP at 6 µg/mg lysate. HO-1 was also immunoprecipitated by rabbit anti-HO-1 antibody which recognizes an upstream epitope. Detection: Chemiluminescence with exposure times of 3 minutes (A) and 30 seconds (B).

FAQ & Publications

Frequently Asked Questions

What applications is the rabbit anti-HO1 polyclonal antibody 1008 validated for?

This antibody is validated for use in Western Blot (WB) and Immunoprecipitation (IP) applications.

How should the rabbit anti-HO1 polyclonal antibody 1008 be stored for optimal stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be stored at -20°C and freeze/thaw cycles should be avoided.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.