Skip to content

rabbit anti-HIF1a monoclonal antibody BL1243F7 1009

Price range: $127.00 through $300.00

Antibody summary

  • Rabbit polyclonal to HIF-1α (Hypoxia-inducible factor 1-alpha)
  • Suitable for: ChIP, ICC, IHC, IP, WB
  • Reacts with: Hu
  • Isotype: IgG
  • 100 µL (10 blots), 20 µL
SKU: 1009parent Categories: , Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

rabbit

isotype

IgG

clonality

monoclonal

concentration

0.4 mg/mL

applications

ChIP, ICC, IHC, IP, WB

reactivity

human

available sizes

100 µL, 20 µL

rabbit anti- hif1a monoclonal antibody BL1243F7 1009

antibody
Database link:
human Q16665
Tested applications
ChIP, ICC, IHC, IP, WB
Recommended dilutions
ChIP-Seq 10 µl per 30 µg of chromatin, Immunocytochemistry (ICC) 1:100 - 1:1000. Epitope retrieval with citrate buffer pH 6.0 for 20 minutes using a pressure cooker is recommended for FFPE cell sections, Immunohistochemistry (IHC)1:100 - 1:1000. Epitope retrieval with citrate buffer pH 6
Immunogen
Between 433 and 826
Size and concentration
100µL and 0.4 mg/mL
Form
liquid
Storage Instructions
2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Storage buffer
Borate Buffered Saline (BBS) pH 8.2 with 0.1% BSA and 0.09% Sodium Azide
Purity
affinity purified
Clonality
monoclonal
Isotype
IgG
Compatible secondaries
goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863
goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control
Rabbit monoclonal - Isotype Control
target relevance
Homo sapiens HIF1A
Hypoxia-inducible factor 1-alpha
Protein names
Hypoxia-inducible factor 1-alpha
Alternative names
ARNT-interacting protein, Basic-helix-loop-helix-PAS protein MOP1, Class E basic helix-loop-helix protein 78, Member of PAS protein 1, PAS domain-containing protein 8
Gene names
HIF1A
Function
Functions as a master transcriptional regulator of the adaptive response to hypoxia (PubMed:11292861, PubMed:11566883, PubMed:15465032, PubMed:16973622, PubMed:17610843, PubMed:18658046, PubMed:20624928, PubMed:22009797, PubMed:30125331, PubMed:9887100). Under hypoxic conditions, activates the transcription of over 40 genes, including erythropoietin, glucose transporters, glycolytic enzymes, vascular endothelial growth factor, HILPDA, and other genes whose protein products increase oxygen delivery or facilitate metabolic adaptation to hypoxia (PubMed:11292861, PubMed:11566883, PubMed:15465032, PubMed:16973622, PubMed:17610843, PubMed:20624928, PubMed:22009797, PubMed:30125331, PubMed:9887100). Plays an essential role in embryonic vascularization, tumor angiogenesis and pathophysiology of ischemic disease (PubMed:22009797). Heterodimerizes with ARNT; heterodimer binds to core DNA sequence 5'-TACGTG-3' within the hypoxia response element (HRE) of target gene promoters (By similarity). Activation requires recruitment of transcriptional coactivators such as CREBBP and EP300 (PubMed:16543236, PubMed:9887100). Activity is enhanced by interaction with NCOA1 and/or NCOA2 (PubMed:10594042). Interaction with redox regulatory protein APEX1 seems to activate CTAD and potentiates activation by NCOA1 and CREBBP (PubMed:10202154, PubMed:10594042). Involved in the axonal distribution and transport of mitochondria in neurons during hypoxia (PubMed:19528298)
Subcellular location
Cytoplasm, Nucleus, Nucleus speckle
Structure
Interacts with the ARNT; forms a heterodimer that binds core DNA sequence 5'-TACGTG-3' within the hypoxia response element (HRE) of target gene promoters (PubMed:10944113, PubMed:20699359). Interacts with COPS5; the interaction increases the transcriptional activity of HIF1A through increased stability (By similarity). Interacts with EP300 (via TAZ-type 1 domains); the interaction is stimulated in response to hypoxia and inhibited by CITED2 (PubMed:11959990, PubMed:12778114, PubMed:16543236, PubMed:16973622, PubMed:8917528, PubMed:9887100). Interacts with CREBBP (via TAZ-type 1 domains) (PubMed:11959977, PubMed:8917528). Interacts with NCOA1, NCOA2, APEX1 and HSP90 (PubMed:10202154, PubMed:10594042). Interacts (hydroxylated within the ODD domain) with VHLL (via beta domain); the interaction, leads to polyubiquitination and subsequent HIF1A proteasomal degradation (PubMed:14757845). During hypoxia, sumoylated HIF1A also binds VHL; the interaction promotes the ubiquitination of HIF1A (PubMed:10944113, PubMed:11006129, PubMed:12004076, PubMed:12050673, PubMed:16862177). Interacts with SENP1; the interaction desumoylates HIF1A resulting in stabilization and activation of transcription (By similarity). Interacts (via the ODD domain) with NAA10; the interaction appears not to acetylate HIF1A nor have any affect on protein stability, during hypoxia (PubMed:12464182, PubMed:16288748). Interacts with RWDD3; the interaction enhances HIF1A sumoylation (PubMed:17956732, PubMed:23469069). Interacts with TSGA10 (By similarity). Interacts with HIF3A (By similarity). Interacts with RORA (via the DNA binding domain); the interaction enhances HIF1A transcription under hypoxia through increasing protein stability (PubMed:18658046). Interaction with PSMA7 inhibits the transactivation activity of HIF1A under both normoxic and hypoxia-mimicking conditions (PubMed:11389899). Interacts with USP20 (PubMed:15776016). Interacts with RACK1; promotes HIF1A ubiquitination and proteasome-mediated degradation (PubMed:17244529). Interacts (via N-terminus) with USP19 (PubMed:22128162). Interacts with SIRT2 (PubMed:24681946). Interacts (deacetylated form) with EGLN1 (PubMed:24681946). Interacts with CBFA2T3 (PubMed:25974097). Interacts with HSP90AA1 and HSP90AB1 (PubMed:26517842). Interacts with DCUN1D1; this interaction increases the interaction between VHL and DCUN1D1 (PubMed:23401859). Interacts with HIF1AN (PubMed:12446723)
Post-translational modification
S-nitrosylation of Cys-800 may be responsible for increased recruitment of p300 coactivator necessary for transcriptional activity of HIF-1 complex
Requires phosphorylation for DNA-binding. Phosphorylation at Ser-247 by CSNK1D/CK1 represses kinase activity and impairs ARNT binding (PubMed:20699359, PubMed:20889502). Phosphorylation by GSK3-beta and PLK3 promote degradation by the proteasome (By similarity)
Sumoylated; with SUMO1 under hypoxia (PubMed:15465032, PubMed:15776016, PubMed:17610843). Sumoylation is enhanced through interaction with RWDD3 (PubMed:17956732). Both sumoylation and desumoylation seem to be involved in the regulation of its stability during hypoxia (PubMed:15465032, PubMed:15776016, PubMed:17610843). Sumoylation can promote either its stabilization or its VHL-dependent degradation by promoting hydroxyproline-independent HIF1A-VHL complex binding, thus leading to HIF1A ubiquitination and proteasomal degradation (PubMed:15465032, PubMed:15776016, PubMed:17610843). Desumoylation by SENP1 increases its stability amd transcriptional activity (By similarity). There is a disaccord between various publications on the effect of sumoylation and desumoylation on its stability and transcriptional activity (Probable)
Acetylation of Lys-532 by ARD1 increases interaction with VHL and stimulates subsequent proteasomal degradation (PubMed:12464182). Deacetylation of Lys-709 by SIRT2 increases its interaction with and hydroxylation by EGLN1 thereby inactivating HIF1A activity by inducing its proteasomal degradation (PubMed:24681946)
Polyubiquitinated; in normoxia, following hydroxylation and interaction with VHL. Lys-532 appears to be the principal site of ubiquitination. Clioquinol, the Cu/Zn-chelator, inhibits ubiquitination through preventing hydroxylation at Asn-803. Ubiquitinated by E3 ligase VHL (PubMed:25615526). Deubiquitinated by UCHL1 (PubMed:25615526)
In normoxia, is hydroxylated on Pro-402 and Pro-564 in the oxygen-dependent degradation domain (ODD) by EGLN1/PHD2 and EGLN2/PHD1 (PubMed:11292861, PubMed:11566883, PubMed:12351678, PubMed:15776016, PubMed:25974097). EGLN3/PHD3 has also been shown to hydroxylate Pro-564 (PubMed:11292861, PubMed:11566883, PubMed:12351678, PubMed:15776016, PubMed:25974097). The hydroxylated prolines promote interaction with VHL, initiating rapid ubiquitination and subsequent proteasomal degradation (PubMed:11292861, PubMed:11566883, PubMed:12351678, PubMed:15776016, PubMed:25974097). Deubiquitinated by USP20 (PubMed:11292861, PubMed:11566883, PubMed:12351678, PubMed:15776016, PubMed:25974097). Under hypoxia, proline hydroxylation is impaired and ubiquitination is attenuated, resulting in stabilization (PubMed:11292861, PubMed:11566883, PubMed:12351678, PubMed:15776016, PubMed:25974097). In normoxia, is hydroxylated on Asn-803 by HIF1AN, thus abrogating interaction with CREBBP and EP300 and preventing transcriptional activation (PubMed:12080085). This hydroxylation is inhibited by the Cu/Zn-chelator, Clioquinol (PubMed:12080085). Repressed by iron ion, via Fe(2+) prolyl hydroxylase (PHD) enzymes-mediated hydroxylation and subsequent proteasomal degradation (PubMed:28296633)
The iron and 2-oxoglutarate dependent 3-hydroxylation of asparagine is (S) stereospecific within HIF CTAD domains
(Microbial infection) Glycosylated at Arg-18 by enteropathogenic E.coli protein NleB1: arginine GlcNAcylation enhances transcription factor activity and impairs glucose metabolism
Keywords
3D-structure, Acetylation, Activator, Alternative splicing, Cytoplasm, Direct protein sequencing, DNA-binding, Glycoprotein, Host-virus interaction, Hydroxylation, Isopeptide bond, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Repeat, S-nitrosylation, Transcription, Transcription regulation, Ubl conjugation
Sequence
MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVM RLTISYLRVRKLLDAGDLDIEDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYM GLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGLVKKGKEQNTQRSFFLRMKCTLTSRGR TMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSK TFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQV TTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECV LKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTET DDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEP NPESLELSFTMPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLF AEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVT VFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYR DTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKR KMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLAC RLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
UniProt accession: Q16665

Data

WB-image-anti-HIF-1alpha (Hypoxia-inducible factor 1-alpha) antibody-10
Detection of human HIF1-alpha by western blot of HeLa and Hep-G2 cell lysate treated with 200 µM CoCl2 (+) or mock treated (-). Antibody: Rabbit anti-HIF1-alpha recombinant monoclonal antibody [BL-124-3F7] used at 1:1000. Secondary: HRP-conjugated goat anti-rabbit IgG. Detection: Chemiluminescence with an exposure time of 30 seconds. Lower Panel: Rabbit anti-COPB2 antibody.
WB-image-anti-HIF-1alpha (Hypoxia-inducible factor 1-alpha) antibody-10
Detection of human HIF1-alpha by western blot of immunoprecipitates from HeLa lysate treated with 200 µM CoCl2 (+) or mock treated (-). Antibodies: Rabbit anti-HIF1-alpha recombinant monoclonal antibody [BL-124-3F7] used for IP at 20 µl/mg lysate. HIF1-alpha was also immunoprecipitated by a previous lot of this antibody. For blotting immunoprecipitated HIF1-alpha, #1009 was used at 1:1000. Detection: Chemiluminescence with an exposure time of 3 seconds.
IHC-image-anti-HIF-1alpha (Hypoxia-inducible factor 1-alpha) antibody-1
Detection of human Hif1-alpha in FFPE clear cell renal cell carcinoma by immunohistochemistry. Antibody: Rabbit anti-Hif1-alpha recombinant monoclonal antibody [BL-124-3F7] #1009. Secondary: HRP-conjugated goat anti-rabbit IgG. Substrate: DAB.
IHC-image-anti-HIF-1alpha (Hypoxia-inducible factor 1-alpha) antibody-1
Detection of human Hif1-alpha in FFPE Hep-G2 cells treated with cobalt chloride by immunocytochemistry. Antibody: Rabbit anti-Hif1-alpha recombinant monoclonal antibody [BL-124-3F7]. Secondary: HRP-conjugated goat anti-rabbit IgG. Substrate: DAB.
MS-image-anti-HIF-1alpha (Hypoxia-inducible factor 1-alpha) antibody-10
Localization of HIF1-alpha Binding Sites by ChIP-sequencing. Chromatin from CoCl2 treated Hep-G2 cells was immunoprecipitated with anti-HIF1 alpha antibody #1009 and analyzed by DNA sequencing. The figure illustrates the peak distribution of HIF1 alpha binding within a 250 Kb region of chromosome 11 as detected using anti-HIF1-alpha antibody #1009. ChIP-seq validation performed by Active Motif, Carlsbad, CA.

FAQ & Publications

Frequently Asked Questions
What applications has the rabbit anti-HIF1a monoclonal antibody BL1243F7 been validated for?
This antibody has been tested and validated for use in Chromatin Immunoprecipitation (ChIP), Immunocytochemistry (ICC), Immunohistochemistry (IHC), Immunoprecipitation (IP), and Western Blot (WB) applications.
How should the rabbit anti-HIF1a monoclonal antibody BL1243F7 be stored to maintain stability?
For short-term storage, keep the antibody at 2-8°C. For long-term storage, it is recommended to store the antibody at -20°C and to avoid repeated freeze/thaw cycles to maintain antibody integrity.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
Western blot

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.