Skip to content

rabbit anti-HBcAg monoclonal antibody (Poly) 6207

Price range: $160.00 through $528.00

Antibody summary

  • Rabbit monoclonal to Hepatitis B Virus (HPB) HBcAg
  • Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
  • Reacts with: Human
  • Isotype:IgG
  • Control: Hepatitis B infected liver
  • Visualization: Nuclear
  • 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
SKU: 6207parent Categories: , Tags: , ,
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

mouse

isotype

IgG

clonality

monoclonal

concentration

concentrate, predilute

applications

IHC

reactivity

human

available size

0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-HBcAg monoclonal antibody Poly 6207

antibody
https://www.uniprot.org/uniprotkb/P03148/
Tested applications
IHC
Recommended dilutions
Concentrated 1:50-100
Application Notes
Positive control: Hepatitis B infected liver
Immunogen
Hepatitis B virus
Size and concentration
7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form
liquid
Storage Instructions
2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity
affinity purified
Clonality
monoclonal
Isotype
IgG
Compatible secondaries
goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863
goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control
Rabbit polyclonal - Isotype Control
target relevance
Hepatitis B virus genotype A2 subtype adw2 (strain Rutter 1979) C
Capsid protein
Protein names
Capsid protein
Alternative names
Core antigen, Core protein, HBcAg, p21.5
Gene names
C
Protein family
Belongs to the orthohepadnavirus core antigen family
Function
Self assembles to form an icosahedral capsid. Most capsids appear to be large particles with an icosahedral symmetry of T=4 and consist of 240 copies of capsid protein, though a fraction forms smaller T=3 particles consisting of 180 capsid proteins. Entering capsids are transported along microtubules to the nucleus. Phosphorylation of the capsid is thought to induce exposure of nuclear localization signal in the C-terminal portion of the capsid protein that allows binding to the nuclear pore complex via the importin (karyopherin-) alpha and beta. Capsids are imported in intact form through the nuclear pore into the nuclear basket, where it probably binds NUP153. Only capsids that contain the mature viral genome can release the viral DNA and capsid protein into the nucleoplasm. Immature capsids get stuck in the basket. Capsids encapsulate the pre-genomic RNA and the P protein. Pre-genomic RNA is reverse-transcribed into DNA while the capsid is still in the cytoplasm. The capsid can then either be directed to the nucleus, providing more genomes for transcription, or bud through the endoplasmic reticulum to provide new virions
Subcellular location
Virion, Host cytoplasm
Structure
Homodimerizes, then multimerizes. Interacts with cytosol exposed regions of viral L glycoprotein present in the reticulum-to-Golgi compartment (PubMed:31700077). Interacts with human FLNB (PubMed:10754391). Phosphorylated form interacts with host importin alpha; this interaction depends on the exposure of the NLS, which itself depends upon genome maturation and/or phosphorylation of the capsid protein. Interacts with host NUP153
Post-translational modification
Phosphorylated by host SRPK1, SRPK2, and maybe protein kinase C or GAPDH. Phosphorylation is critical for pregenomic RNA packaging. Protein kinase C phosphorylation is stimulated by HBx protein and may play a role in transport of the viral genome to the nucleus at the late step during the viral replication cycle
Keywords
Alternative initiation, Capsid protein, Cytoplasmic inwards viral transport, DNA-binding, Host cytoplasm, Host-virus interaction, Microtubular inwards viral transport, Phosphoprotein, Repeat, RNA-binding, T=4 icosahedral capsid protein, Viral penetration into host nucleus, Virion, Virus entry into host cell
Sequence
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIL CWGELMTLATWVGNNLEDPASRDLVVNYVNTNVGLKIRQLLWFHISCLTFGRETVLEYLV SFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSPSPRRRRSQS RESQC
UniProt accession: P03148

Data

Human liver infected with hepatitis B virus stained with anti-HBcAg antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of infected hepatocytes.
Human liver infected with hepatitis B virus stained with anti-HBcAg antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of infected hepatocytes.

FAQ & Publications

Frequently Asked Questions
What is the recommended dilution range for using the rabbit anti-HBcAg monoclonal antibody (Poly) 6207 in immunohistochemistry?
For immunohistochemistry applications, the concentrated rabbit anti-HBcAg monoclonal antibody (Poly) 6207 is recommended to be diluted between 1:50 and 1:100.
How should the rabbit anti-HBcAg monoclonal antibody (Poly) 6207 be stored to maintain its stability?
This antibody should be stored at 2-8°C for short-term use. For long-term storage, it is recommended to keep the antibody at -20°C and to avoid repeated freeze-thaw cycles to preserve its stability and functionality.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
IHC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.