Immunohistochemistry (IHC) : Human liver infected with hepatitis B virus stained with anti-HBcAg antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of infected hepatocytes.

rabbit anti-HBcAg monoclonal antibody (Poly) 6207

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to Hepatitis B Virus (HPB) HBcAg
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Hepatitis B infected liver
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6207parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, HBcAg, Infectious Markers

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-HBcAg monoclonal antibody Poly 6207

antibody
https://www.uniprot.org/uniprotkb/P03148/
Tested applications IHC
Recommended dilutions Concentrated 1:50-100
Application Notes Positive control: Hepatitis B infected liver
Immunogen Hepatitis B virus
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Hepatitis B virus genotype A2 subtype adw2 (strain Rutter 1979) C Capsid protein
Protein names Capsid protein
Alternative names Core antigen, Core protein, HBcAg, p21.5
Gene names C
Protein family Belongs to the orthohepadnavirus core antigen family
Function Self assembles to form an icosahedral capsid. Most capsids appear to be large particles with an icosahedral symmetry of T=4 and consist of 240 copies of capsid protein, though a fraction forms smaller T=3 particles consisting of 180 capsid proteins. Entering capsids are transported along microtubules to the nucleus. Phosphorylation of the capsid is thought to induce exposure of nuclear localization signal in the C-terminal portion of the capsid protein that allows binding to the nuclear pore complex via the importin (karyopherin-) alpha and beta. Capsids are imported in intact form through the nuclear pore into the nuclear basket, where it probably binds NUP153. Only capsids that contain the mature viral genome can release the viral DNA and capsid protein into the nucleoplasm. Immature capsids get stuck in the basket. Capsids encapsulate the pre-genomic RNA and the P protein. Pre-genomic RNA is reverse-transcribed into DNA while the capsid is still in the cytoplasm. The capsid can then either be directed to the nucleus, providing more genomes for transcription, or bud through the endoplasmic reticulum to provide new virions
Subcellular location Virion, Host cytoplasm
Structure Homodimerizes, then multimerizes. Interacts with cytosol exposed regions of viral L glycoprotein present in the reticulum-to-Golgi compartment (PubMed:31700077). Interacts with human FLNB (PubMed:10754391). Phosphorylated form interacts with host importin alpha; this interaction depends on the exposure of the NLS, which itself depends upon genome maturation and/or phosphorylation of the capsid protein. Interacts with host NUP153
Post-translational modification Phosphorylated by host SRPK1, SRPK2, and maybe protein kinase C or GAPDH. Phosphorylation is critical for pregenomic RNA packaging. Protein kinase C phosphorylation is stimulated by HBx protein and may play a role in transport of the viral genome to the nucleus at the late step during the viral replication cycle
Keywords Alternative initiation, Capsid protein, Cytoplasmic inwards viral transport, DNA-binding, Host cytoplasm, Host-virus interaction, Microtubular inwards viral transport, Phosphoprotein, Repeat, RNA-binding, T=4 icosahedral capsid protein, Viral penetration into host nucleus, Virion, Virus entry into host cell
Sequence MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIL CWGELMTLATWVGNNLEDPASRDLVVNYVNTNVGLKIRQLLWFHISCLTFGRETVLEYLV SFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRRRTPSPRRRRSPSPRRRRSQS RESQC
UniProt accession: P03148

Data

Human liver infected with hepatitis B virus stained with anti-HBcAg antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of infected hepatocytes.

FAQ & Publications

Frequently Asked Questions

What is the recommended dilution range for using the rabbit anti-HBcAg monoclonal antibody (Poly) 6207 in immunohistochemistry?

For immunohistochemistry applications, the concentrated rabbit anti-HBcAg monoclonal antibody (Poly) 6207 is recommended to be diluted between 1:50 and 1:100.

How should the rabbit anti-HBcAg monoclonal antibody (Poly) 6207 be stored to maintain its stability?

This antibody should be stored at 2-8°C for short-term use. For long-term storage, it is recommended to keep the antibody at -20°C and to avoid repeated freeze-thaw cycles to preserve its stability and functionality.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.