| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | GRIM-19 |
| available sizes | 100 µg |
rabbit anti-GRIM-19 polyclonal antibody 6030
$9,999.00
Antibody summary
- Rabbit polyclonal to GRIM-19
- Suitable for: ELISA
- Isotype: Whole IgG
- 100 µg
rabbit anti-GRIM-19 polyclonal antibody 6030
| antibody |
|---|
| Tested applications ELISA |
| Recommended dilutions Immunoblotting: use at 1:500-1:1,000 dilution. A band of approx. 16kDa is detected. Positive control: HeLa cell lysate. These are recommended concentrations. End user should determine optimal concentrations for their applications. |
| Immunogen Recombinant human GRIM-19 protein. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions Store at 2 - 8°C until expiration on packaging. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens NDUFA13 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 |
| Protein names NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 |
| Alternative names Cell death regulatory protein GRIM-19, Complex I-B16.6, Gene associated with retinoic and interferon-induced mortality 19 protein, NADH-ubiquinone oxidoreductase B16.6 subunit |
| Gene names NDUFA13 |
| Protein family Belongs to the complex I NDUFA13 subunit family |
| Function Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis (PubMed:27626371). Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (PubMed:27626371). Involved in the interferon/all-trans-retinoic acid (IFN/RA) induced cell death. This apoptotic activity is inhibited by interaction with viral IRF1. Prevents the transactivation of STAT3 target genes. May play a role in CARD15-mediated innate mucosal responses and serve to regulate intestinal epithelial cell responses to microbes (PubMed:15753091) |
| Subcellular location Mitochondrion inner membrane, Nucleus |
| Structure (Microbial infection) Interacts with HHV-8 IRF1, in the nucleus, with HPV-16 E6 and SV40 LT (PubMed:12163600) |
| Involvement in disease Hurthle cell thyroid carcinoma A rare type of thyroid cancer accounting for only about 3-10% of all differentiated thyroid cancers. These neoplasms are considered a variant of follicular carcinoma of the thyroid and are referred to as follicular carcinoma, oxyphilic type. Mitochondrial complex I deficiency, nuclear type 28 A form of mitochondrial complex I deficiency, the most common biochemical signature of mitochondrial disorders, a group of highly heterogeneous conditions characterized by defective oxidative phosphorylation, which collectively affects 1 in 5-10000 live births. Clinical disorders have variable severity, ranging from lethal neonatal disease to adult-onset neurodegenerative disorders. Phenotypes include macrocephaly with progressive leukodystrophy, non-specific encephalopathy, cardiomyopathy, myopathy, liver disease, Leigh syndrome, Leber hereditary optic neuropathy, and some forms of Parkinson disease. MC1DN28 transmission pattern is consistent with autosomal recessive inheritance. |
| Keywords 3D-structure, Acetylation, Alternative splicing, Apoptosis, Disease variant, Electron transport, Host-virus interaction, Membrane, Mitochondrion, Mitochondrion inner membrane, Nucleus, Primary mitochondrial disease, Proteomics identification, Reference proteome, Respiratory chain, Transmembrane, Transmembrane helix, Transport |
| Sequence MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRL QIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPL IGELYGLRTTEEALHASHGFMWYT |
| UniProt accession: Q9P0J0 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What is the host species and clonality of the anti-GRIM-19 antibody 6030?
The anti-GRIM-19 antibody 6030 is a rabbit polyclonal antibody of the IgG isotype.
Which applications has the rabbit anti-GRIM-19 polyclonal antibody been validated for?
This antibody has been tested and is suitable for ELISA, immunocytochemistry/immunofluorescence (ICC/IF), and Western blotting (WB).
What are the recommended dilutions for immunoblotting using this antibody?
For immunoblotting, the antibody is recommended to be used at a dilution range of 1:500 to 1:1,000, detecting a band of approximately 16 kDa. HeLa cell lysate is suggested as a positive control.
How should the rabbit anti-GRIM-19 antibody be stored to maintain stability?
The antibody should be stored in liquid form at 2 to 8 degrees Celsius until the expiration date indicated on the packaging.
What is the immunogen used to raise this polyclonal antibody?
The immunogen for this antibody is recombinant human GRIM-19 protein.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| ELISA |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.