Immunohistochemistry (IHC) : Human pancreas stained with anti-Glucagon antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of islet cells.

rabbit anti-Glucagon monoclonal antibody (EP74) 6195

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to Glucagon
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Normal pancreas
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6195parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Glucagon, monoclonal, Neuropathology/Endocrine

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-Glucagon monoclonal antibody EP74 6195

antibody
Database link: human P01275
Tested applications IHC
Recommended dilutions Concentrated 1:50-100
Application Notes Positive control: Normal pancreas
Immunogen Synthetic peptide (the amino acid sequence is considered to be commercially sensitive)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens GCG Pro-glucagon
Protein names Pro-glucagon
Gene names GCG
Protein family Belongs to the glucagon family
Function Plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes. Binds to and activates the glucagon receptor GCGR, which couples to the G(s) G protein and elevates intracellular cAMP, triggering downstream metabolic responses (PubMed:32193322)
Subcellular location Secreted
Structure Interacts with GCGR
Post-translational modification Proglucagon is post-translationally processed in a tissue-specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by post-translational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas
Keywords 3D-structure, Amidation, Cleavage on pair of basic residues, Direct protein sequencing, Hormone, Pharmaceutical, Phosphoprotein, Proteomics identification, Reference proteome, Secreted, Signal
Sequence MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTS DYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFI AWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
UniProt accession: P01275

Data

Human pancreas stained with anti-Glucagon antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of islet cells.

FAQ & Publications

Frequently Asked Questions

What species is the rabbit anti-Glucagon monoclonal antibody EP74 validated to react with?

The rabbit anti-Glucagon monoclonal antibody EP74 has been validated to react with human tissue.

What are the recommended storage conditions for maintaining the stability of this antibody?

For short-term storage, keep the antibody at 2-8°C. For longer-term preservation, store it at -20°C and avoid repeated freeze/thaw cycles.

Which applications and tissue types is this antibody suitable for?

This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues, with normal pancreas tissue used as a positive control.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.