Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human breast ductal carcinoma stained with anti-GATA3 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of tumor cells

rabbit anti-GATA-3 monoclonal antibody (ZR358) 6190

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to GATA-3
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Breast or urothelial carcinoma
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6190parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Breast Pathology, GATA-3

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-GATA-3 monoclonal antibody ZR358 6190

antibody
Database link: human P23771
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Breast or urothelial carcinoma
Immunogen Full-length human GATA-3 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens GATA3 Trans-acting T-cell-specific transcription factor GATA-3
Protein names Trans-acting T-cell-specific transcription factor GATA-3
Alternative names GATA-binding factor 3
Gene names GATA3
Function Transcriptional activator which binds to the enhancer of the T-cell receptor alpha and delta genes. Binds to the consensus sequence 5'-AGATAG-3'. Required for the T-helper 2 (Th2) differentiation process following immune and inflammatory responses. Positively regulates ASB2 expression (By similarity). Coordinates macrophage transcriptional activation and UCP2-dependent metabolic reprogramming in response to IL33. Upon tissue injury, acts downstream of IL33 signaling to drive differentiation of inflammation-resolving alternatively activated macrophages
Subcellular location Nucleus
Structure Interacts with TBX21 ('Tyr-530' phosphorylated form)
Involvement in disease Hypoparathyroidism, sensorineural deafness, and renal disease A disease characterized by steroid-resistant nephrosis with progressive renal failure, hypoparathyroidism, sensorineural deafness, and renal dysplasia.
Keywords 3D-structure, Activator, Alternative splicing, Deafness, Disease variant, DNA-binding, Immunity, Innate immunity, Metal-binding, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Repeat, Transcription, Transcription regulation, Zinc, Zinc-finger
Sequence MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHV PPYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKT SIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDE KECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPYVPEYSSGLFPPSSLL GGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPL IKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEG IQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPT PMHPPSSLSFGPHHPSSMVTAMG
UniProt accession: P23771

Data

Formalin-fixed, paraffin-embedded human breast ductal carcinoma stained with anti-GATA3 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of tumor cells

FAQ & Publications

Frequently Asked Questions

What is the recommended dilution for using the rabbit anti-GATA-3 monoclonal antibody (ZR358) in immunohistochemistry?

For immunohistochemistry applications, the rabbit anti-GATA-3 monoclonal antibody (ZR358) is recommended to be used at a dilution of 1:100-200 when concentrated.

How should the rabbit anti-GATA-3 monoclonal antibody (ZR358) be stored to ensure stability?

The antibody should be stored at 2-8°C for short-term use, and for longer-term storage, it is recommended to keep it at -20°C while avoiding freeze/thaw cycles to maintain stability.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.