Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human thyroid papillary carcinoma stained with anti-galectin-3 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear and cytoplasmic staining of tumor cells

rabbit anti-Galectin-3 monoclonal antibody (ZR430) 6187

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to Galectin-3
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Papillary or follicular thyroid carcinoma
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6187parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Galectin-3, General & Epithelial Markers

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-Galectin-3 monoclonal antibody ZR430 6187

antibody
Database link: human P17931
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Papillary or follicular thyroid carcinoma
Immunogen A synthetic peptide from the C-terminus of human LGALS3 protein (aa 150-200)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens LGALS3 Galectin-3
Protein names Galectin-3
Alternative names 35 kDa lectin, Carbohydrate-binding protein 35, Galactose-specific lectin 3, Galactoside-binding protein, IgE-binding protein, L-31, Laminin-binding protein, Lectin L-29, Mac-2 antigen
Gene names LGALS3
Function Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration. Together with DMBT1, required for terminal differentiation of columnar epithelial cells during early embryogenesis (By similarity). In the nucleus: acts as a pre-mRNA splicing factor. Involved in acute inflammatory responses including neutrophil activation and adhesion, chemoattraction of monocytes macrophages, opsonization of apoptotic neutrophils, and activation of mast cells. Together with TRIM16, coordinates the recognition of membrane damage with mobilization of the core autophagy regulators ATG16L1 and BECN1 in response to damaged endomembranes
Subcellular location Cytoplasm, Nucleus, Secreted
Structure Probably forms homo- or heterodimers. Interacts with DMBT1 (By similarity). Interacts with CD6 and ALCAM (PubMed:24945728). Forms a complex with the ITGA3, ITGB1 and CSPG4. Interacts with LGALS3BP, LYPD3, ZFTRAF1 and UACA. Interacts with TRIM16; this interaction mediates autophagy of damage endomembranes. Interacts with cargo receptor TMED10; the interaction mediates the translocation from the cytoplasm into the ERGIC (endoplasmic reticulum-Golgi intermediate compartment) and thereby secretion (PubMed:32272059)
Keywords 3D-structure, Acetylation, Cytoplasm, Differentiation, Disulfide bond, IgE-binding protein, Immunity, Innate immunity, Lectin, mRNA processing, mRNA splicing, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Repeat, Secreted, Spliceosome
Sequence MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPP GAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNL PLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNN WGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDI DLTSASYTMI
UniProt accession: P17931

Data

Formalin-fixed, paraffin-embedded human thyroid papillary carcinoma stained with anti-galectin-3 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear and cytoplasmic staining of tumor cells

FAQ & Publications

Frequently Asked Questions

What is the recommended application for the rabbit anti-Galectin-3 monoclonal antibody (ZR430)?

This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissue samples.

How should the rabbit anti-Galectin-3 antibody be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For longer-term storage, it should be kept at -20°C, and freeze/thaw cycles should be avoided.

Which host species was used to generate the anti-Galectin-3 monoclonal antibody ZR430?

The antibody was produced in rabbit as a monoclonal antibody with IgG isotype.

What is the immunogen used to raise the rabbit anti-Galectin-3 monoclonal antibody (ZR430)?

The immunogen is a synthetic peptide derived from the C-terminus of the human LGALS3 protein, specifically amino acids 150-200.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.