Skip to content

rabbit anti-GABARAP polyclonal antibody 6462

$389.00

Antibody summary

  • Rabbit polyclonal to GABARAP
  • Suitable for: WB,ELISA
  • Isotype: Whole IgG
  • 100 µg
SKU: 6462parent Category: Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

rabbit

isotype

IgG

clonality

polyclonal

concentration

1 mg/mL

applications

ICC/IF, WB

reactivity

GABA Receptor Associated Protein

available sizes

100 µg

rabbit anti-GABARAP polyclonal antibody 6462

antibody
Tested applications
WB,ELISA
Recommended dilutions
Immunoblotting: use at 1:500-1:1,000 dilution

ELISA: use at 1:1,000-1:5,000 dilution.
Immunogen
Peptide derived from the N- terminus of GABARAP.
Size and concentration
100µg and lot specific
Form
liquid
Storage Instructions
This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze- thaw cycles.
Storage buffer
PBS, pH 7.4.
Purity
immunogen affinity purification
Clonality
polyclonal
Isotype
IgG
Compatible secondaries
goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863
goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control
Rabbit polyclonal - Isotype Control
target relevance
Homo sapiens GABARAP
Gamma-aminobutyric acid receptor-associated protein
Protein names
Gamma-aminobutyric acid receptor-associated protein
Alternative names
GABA(A) receptor-associated protein, MM46
Gene names
GABARAP
Protein family
Belongs to the ATG8 family
Function
Ubiquitin-like modifier that plays a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton (PubMed:9892355). Involved in autophagy: while LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (PubMed:15169837, PubMed:20562859, PubMed:22948227). Through its interaction with the reticulophagy receptor TEX264, participates in the remodeling of subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover (PubMed:31006538). Also required for the local activation of the CUL3(KBTBD6/7) E3 ubiquitin ligase complex, regulating ubiquitination and degradation of TIAM1, a guanyl-nucleotide exchange factor (GEF) that activates RAC1 and downstream signal transduction (PubMed:25684205). Thereby, regulates different biological processes including the organization of the cytoskeleton, cell migration and proliferation (PubMed:25684205). Involved in apoptosis (PubMed:15977068)
Subcellular location
Cytoplasmic vesicle, autophagosome membrane, Endomembrane system, Cytoplasm, cytoskeleton, Golgi apparatus membrane, Cytoplasmic vesicle
Structure
Interacts with GPHN and NSF (By similarity). Interacts with ATG7, ATG13 (PubMed:11096062, PubMed:12507496, PubMed:23043107). Interacts with ATG3 (PubMed:11825910, PubMed:12507496, PubMed:37252361). Interacts with alpha- and beta-tubulin (PubMed:11729197, PubMed:9892355). Interacts with GABRG2 (PubMed:11729197, PubMed:9892355). Interacts with RB1CC1 (PubMed:23043107). Interacts with ULK1 (PubMed:11146101, PubMed:23043107). Interacts with CALR (PubMed:19154346). Interacts with DDX47 (PubMed:15977068). Interacts with TP53INP1 and TP53INP2 (PubMed:19056683, PubMed:22421968, PubMed:22470510). Interacts with TBC1D5 and TBC1D25 (PubMed:21383079, PubMed:22354992). Directly interacts with SQSTM1 (PubMed:17580304, PubMed:24668264). Interacts with MAPK15 (PubMed:22948227). Interacts with TECPR2 (PubMed:20562859). Interacts with PCM1 (PubMed:24089205). Interacts with TRIM5 and TRIM21 (PubMed:25127057, PubMed:26347139). Interacts with MEFV (PubMed:26347139). Interacts with KIF21B (By similarity). Interacts with WDFY3; this interaction is required for WDFY3 recruitment to MAP1LC3B-positive p62/SQSTM1 bodies (PubMed:24668264). Interacts with the reticulophagy receptor TEX264 (PubMed:31006538). Interacts with UBA5 (PubMed:26929408). Interacts with FLCN; interaction regulates autophagy (PubMed:25126726). Interacts with KBTBD6 and KBTBD7; the interaction is direct and required for the ubiquitination of TIAM1 (PubMed:25684205). Interacts with reticulophagy regulators RETREG1, RETREG2 and RETREG3 (PubMed:34338405). Interacts with IRGM (PubMed:29420192). Interacts with STX17 (PubMed:29420192). Interacts with CT55; this interaction may be important for GABARAP protein stability (PubMed:36481789). Interacts with DNM2 (PubMed:32315611). Interacts with NCOA4 (via C-terminus) (By similarity)
Post-translational modification
The precursor molecule is cleaved by ATG4 (ATG4A, ATG4B, ATG4C or ATG4D) to expose the glycine at the C-terminus and form the cytosolic form, GABARAP-I (PubMed:15169837, PubMed:20818167, PubMed:30661429). The processed form is then activated by APG7L/ATG7, transferred to ATG3 and conjugated to phosphatidylethanolamine (PE) phospholipid to form the membrane-bound form, GABARAP-II (PubMed:15169837). During non-canonical autophagy, the processed form is conjugated to phosphatidylserine (PS) phospholipid (PubMed:33909989). ATG4 proteins also mediate the delipidation of PE-conjugated forms (PubMed:33909989). In addition, ATG4B and ATG4D mediate delipidation of ATG8 proteins conjugated to PS during non-canonical autophagy (PubMed:33909989). ATG4B constitutes the major protein for proteolytic activation (PubMed:30661429). ATG4D is the main enzyme for delipidation activity (By similarity)
(Microbial infection) The Legionella effector RavZ is a deconjugating enzyme that hydrolyzes the amide bond between the C-terminal glycine residue and an adjacent aromatic residue in ATG8 proteins conjugated to phosphatidylethanolamine (PE), producing an ATG8 protein that is resistant to reconjugation by the host machinery due to the cleavage of the reactive C-terminal glycine (PubMed:31722778). RavZ is also able to mediate delipidation of ATG8 proteins conjugated to phosphatidylserine (PS) (PubMed:33909989)
Keywords
3D-structure, Apoptosis, Autophagy, Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Golgi apparatus, Lipoprotein, Membrane, Microtubule, Protein transport, Proteomics identification, Reference proteome, Transport
Sequence
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
UniProt accession: O95166

Data

No results found

FAQ & Publications

Frequently Asked Questions
What applications has the rabbit anti-GABARAP polyclonal antibody 6462 been tested for?
This antibody has been tested and is suitable for Western blotting (WB) and ELISA applications.
How should the rabbit anti-GABARAP antibody be stored to maintain its stability?
The antibody should be stored at -20°C and is stable for at least one year. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the host species and clonality of the anti-GABARAP antibody 6462?
The antibody is a rabbit polyclonal antibody of the IgG isotype.
What is the recommended dilution range for using this antibody in Western blot and ELISA?
For Western blotting, use the antibody at a dilution of 1:500 to 1:1,000. For ELISA, the recommended dilution range is 1:1,000 to 1:5,000.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
Western blot
IHC
ICC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.