| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | GABABR2 |
| available sizes | 100 µg |
rabbit anti-GABA (B)R2 polyclonal antibody 4702
$376.00
Antibody summary
- Rabbit polyclonal to GABA (B)R2
- Suitable for: WB
- Isotype: Whole IgG
- 100 µg
rabbit anti-GABA (B)R2 polyclonal antibody 4702
| antibody |
|---|
| Tested applications WB |
| Recommended dilutions Immunoblotting: use at 1:250 - 1:1,000 dilution. A band of ~105kDa is detected. |
| Immunogen Synthetic peptide corresponding to aa 42-54 (TRGAPRPPPSSPP) of the rat GABABR2 subunit. |
| Size and concentration 100µg and 1 mg/mL |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4, 0.02% NaN3. |
| Purity protein affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens GABBR2 Gamma-aminobutyric acid type B receptor subunit 2 |
| Protein names Gamma-aminobutyric acid type B receptor subunit 2 |
| Alternative names G-protein coupled receptor 51, HG20 |
| Gene names GABBR2 |
| Protein family Belongs to the G-protein coupled receptor 3 family. GABA-B receptor subfamily |
| Function Component of a heterodimeric G-protein coupled receptor for GABA, formed by GABBR1 and GABBR2 (PubMed:15617512, PubMed:18165688, PubMed:22660477, PubMed:24305054, PubMed:9872316, PubMed:9872744). Within the heterodimeric GABA receptor, only GABBR1 seems to bind agonists, while GABBR2 mediates coupling to G proteins (PubMed:18165688). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase (PubMed:10075644, PubMed:10773016, PubMed:24305054). Signaling inhibits adenylate cyclase, stimulates phospholipase A2, activates potassium channels, inactivates voltage-dependent calcium-channels and modulates inositol phospholipid hydrolysis (PubMed:10075644, PubMed:10773016, PubMed:10906333, PubMed:9872744). Plays a critical role in the fine-tuning of inhibitory synaptic transmission (PubMed:22660477, PubMed:9872744). Pre-synaptic GABA receptor inhibits neurotransmitter release by down-regulating high-voltage activated calcium channels, whereas postsynaptic GABA receptor decreases neuronal excitability by activating a prominent inwardly rectifying potassium (Kir) conductance that underlies the late inhibitory postsynaptic potentials (PubMed:10075644, PubMed:22660477, PubMed:9872316, PubMed:9872744). Not only implicated in synaptic inhibition but also in hippocampal long-term potentiation, slow wave sleep, muscle relaxation and antinociception (Probable) |
| Subcellular location Cell membrane, Postsynaptic cell membrane |
| Structure Heterodimer of GABBR1 and GABBR2 (PubMed:10773016, PubMed:10906333, PubMed:15617512, PubMed:18165688, PubMed:22660477, PubMed:24305054, PubMed:9872316, PubMed:9872744). Homodimers may form, but are inactive (PubMed:15617512). Interacts (via C-terminus) with ATF4 (via leucine zipper domain) (By similarity) |
| Involvement in disease Neurodevelopmental disorder with poor language and loss of hand skills An autosomal dominant disorder characterized by psychomotor developmental stagnation or regression. NDPLHS manifest in the first years of life as loss of purposeful hand movements, loss of language, and intellectual disability. Developmental and epileptic encephalopathy 59 A form of epileptic encephalopathy, a heterogeneous group of severe early-onset epilepsies characterized by refractory seizures, neurodevelopmental impairment, and poor prognosis. Development is normal prior to seizure onset, after which cognitive and motor delays become apparent. DEE59 is an autosomal dominant condition characterized by onset of refractory seizures in early infancy. |
| Keywords 3D-structure, Cell membrane, Coiled coil, Direct protein sequencing, Disease variant, Disulfide bond, Epilepsy, G-protein coupled receptor, Glycoprotein, Intellectual disability, Membrane, Phosphoprotein, Postsynaptic cell membrane, Proteomics identification, Receptor, Reference proteome, Signal, Synapse, Transducer, Transmembrane, Transmembrane helix |
| Sequence MASPRSSGQPGPPPPPPPPPARLLLLLLLPLLLPLAPGAWGWARGAPRPPPSSPPLSIMG LMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDA IKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDN AVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSV KKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQVHTEANSS RCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYD GIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNG ERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILEQLRKISLP LYSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGLD GSFVSEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVKMKKKIIKDQKLLVI VGGMLLIDLCILICWQAVDPLRRTVEKYSMEPDPAGRDISIRPLLEHCENTHMTIWLGIV YAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQPNVQ FCIVALVIIFCSTITLCLVFVPKLITLRTNPDAATQNRRFQFTQNQKKEDSKTSTSVTSV NQASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDTPEKTTYIKQNHYQELNDILNL GNFTESTDGGKAILKNHLDQNPQLQWNTTEPSRTCKDPIEDINSPEHIQRRLSLQLPILH HAYLPSIGGVDASCVSPCVSPTASPRHRHVPPSFRVMVSGL |
| UniProt accession: O75899 |
Data
 |
| Immunoblotting: use at 1:250 - 1:1,000 dilution. A band of ~105kDa is detected. Western blot analysis of GABABR2 in rat brain lysate with #4702 at a 1:500 dilution. |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-GABA (B)R2 polyclonal antibody 4702 been validated for?
This antibody has been tested and is suitable for Western blot (WB) applications, with recommended dilutions ranging from 1:250 to 1:1,000. It is also applicable for immunocytochemistry/immunofluorescence (ICC/IF).
How should the rabbit anti-GABA (B)R2 antibody 4702 be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the immunogen used to generate the rabbit anti-GABA (B)R2 polyclonal antibody 4702?
The antibody was raised against a synthetic peptide corresponding to amino acids 42-54 (sequence: TRGAPRPPPSSPP) of the rat GABABR2 subunit.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.