Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human normal pituitary stained with anti-FSH antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of FSH secreting cells

rabbit anti-FSH monoclonal antibody (ZR246) 6186

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to FSH
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Pituitary
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6186parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, FSH, monoclonal, Neuropathology/Endocrine

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-FSH monoclonal antibody ZR246 6186

antibody
Database link: human P01225
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Pituitary
Immunogen Recombinant full-length hFSH beta sub-unit
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens FSHB Follitropin subunit beta
Protein names Follitropin subunit beta
Alternative names Follicle-stimulating hormone beta subunit, Follitropin beta chain
Gene names FSHB
Protein family Belongs to the glycoprotein hormones subunit beta family
Function Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways (PubMed:24692546, PubMed:2494176). Follitropin is involved in follicle development and spermatogenesis in reproductive organs (PubMed:407105, PubMed:8220432)
Subcellular location Secreted
Structure Heterodimer. The active follitropin is a heterodimer composed of an alpha chain/CGA shared with other hormones and a unique beta chain/FSHB shown here
Involvement in disease Hypogonadotropic hypogonadism 24 with or without anosmia A form of hypogonadotropic hypogonadism, a group of disorders characterized by absent or incomplete sexual maturation by the age of 18 years, in conjunction with low levels of circulating gonadotropins and testosterone and no other abnormalities of the hypothalamic-pituitary axis. HH24 is characterized by primary amenorrhea in women, oligo or azoospermia with low to normal testosterone levels in men, and infertility.
Keywords 3D-structure, Direct protein sequencing, Disease variant, Disulfide bond, Glycoprotein, Hormone, Hypogonadotropic hypogonadism, Pharmaceutical, Proteomics identification, Reference proteome, Secreted, Signal
Sequence MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDP ARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPS YCSFGEMKE
UniProt accession: P01225

Data

Formalin-fixed, paraffin-embedded human normal pituitary stained with anti-FSH antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of FSH secreting cells

FAQ & Publications

Frequently Asked Questions

What applications is the rabbit anti-FSH monoclonal antibody (ZR246) validated for?

This antibody is validated for use in immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues.

How should the rabbit anti-FSH monoclonal antibody be stored to maintain stability?

Store the antibody at 2-8°C for short-term use and at -20°C for long-term storage, avoiding freeze/thaw cycles to preserve antibody integrity.

What is the recommended dilution range for the concentrated form of this anti-FSH antibody in IHC?

For immunohistochemistry applications, a recommended dilution range of 1:100 to 1:200 is suggested for the concentrated antibody format.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.