rabbit anti-Doublecortin monoclonal antibody 9059

$409.00

Antibody summary

Rabbit monoclonal to Doublecortin
Suitable for: WB, ICC/IF, IHC
Reacts with: human, mouse, rat
Isotype: IgG
100 µg

SKU: 9059 Categories: antibody, cell marker Tag: Doublecortin

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	rabbit
isotype	IgG
clonality	monoclonal
concentration	1 mg/mL
applications	ICC/IF, IHC, WB
available sizes	100 µg

rabbit anti-Doublecortin monoclonal antibody 9059

antibody
Database link: human O43602 mouse O88809 rat Q9ESI7
Tested applications WB,IHC,IHC,ICC/IF
Recommended dilutions WB: 1:1000 IF/ICC and IHC: 1:1000
Immunogen Recombinant full length human Lis-A isoform of doublecortin expressed in and purified from E. coli
Size and concentration 100µg and 1 mg/mL
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Storage buffer PBS, 50% glycerol, 0.04% NaN₃
Purity affinity purified
Clonality polyclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal- Isotype Control

target relevance
Homo sapiens DCX Neuronal migration protein doublecortin
Protein names Neuronal migration protein doublecortin
Alternative names Doublin, Lissencephalin-X
Gene names DCX
Function Microtubule-associated protein required for initial steps of neuronal dispersion and cortex lamination during cerebral cortex development. May act by competing with the putative neuronal protein kinase DCLK1 in binding to a target protein. May in that way participate in a signaling pathway that is crucial for neuronal interaction before and during migration, possibly as part of a calcium ion-dependent signal transduction pathway. May be part with PAFAH1B1/LIS-1 of overlapping, but distinct, signaling pathways that promote neuronal migration
Subcellular location Cytoplasm, Cell projection, neuron projection
Structure Interacts with tubulin (PubMed:27292316). Interacts with USP9X (PubMed:24607389)
Post-translational modification Phosphorylation by MARK1, MARK2 and PKA regulates its ability to bind microtubules (By similarity). Phosphorylation at Ser-265 and Ser-297 seems to occur only in neonatal brain, the levels falling precipitously by postnatal day 21 (By similarity) Ubiquitinated by MDM2, leading to its degradation by the proteasome. Ubiquitinated by MDM2 and subsequent degradation leads to reduce the dendritic spine density of olfactory bulb granule cells
Involvement in disease Lissencephaly, X-linked 1 A classic lissencephaly characterized by intellectual disability and seizures that are more severe in male patients. Affected boys show an abnormally thick cortex with absent or severely reduced gyri. Clinical manifestations include feeding problems, abnormal muscular tone, seizures and severe to profound psychomotor retardation. Female patients display a less severe phenotype referred to as 'doublecortex'. Subcortical band heterotopia X-linked SBHX is a mild brain malformation of the lissencephaly spectrum. It is characterized by bilateral and symmetric plates or bands of gray matter found in the central white matter between the cortex and cerebral ventricles, cerebral convolutions usually appearing normal.
Keywords 3D-structure, Alternative splicing, Cell projection, Chromosomal rearrangement, Cytoplasm, Developmental protein, Differentiation, Disease variant, Epilepsy, Lissencephaly, Microtubule, Neurogenesis, Phosphoprotein, Proteomics identification, Reference proteome, Repeat, Ubl conjugation
Sequence MELDFGHFDERDKTSRNMRGSRMNGLPSPTHSAHCSFYRTRTLQALSNEKKAKKVRFYRN GDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELE EGESYVCSSDNFFKKVEYTKNVNPNWSVNVKTSANMKAPQSLASSNSAQARENKDFVRPK LVTIIRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKLETGVVKKLYTLDGKQVTCLH DFFGDDDVFIACGPEKFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGP MRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLYLPLSLDDSDS LGDSM
UniProt accession: O43602

Data

benchmarkantibodies.com/wp-content/uploads/2024/03/9059_1.jpg

Detection of human Doublecortin by Western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from SK-N-BE(2) cells prepared using NETN lysis buffer. Antibodies: Rabbit anti-Doublecortin recombinant monoclonal antibody 9059 used for IP at 20 µl/mg lysate. Doublecortin was also immunoprecipitated by a second antibody against a different epitope of Doublecortin. For blotting immunoprecipitated Doublecortin, 9059 was used at 1:1000. Detection: Chemiluminescence with an exposure time of 10 seconds.

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-Doublecortin monoclonal antibody 9059 react with?

This antibody reacts with human, mouse, and rat species.

Which applications is the rabbit anti-Doublecortin monoclonal antibody 9059 validated for?

It is suitable for Western blot (WB), immunocytochemistry/immunofluorescence (ICC/IF), and immunohistochemistry (IHC) applications.

How should the rabbit anti-Doublecortin monoclonal antibody 9059 be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be stored at -20°C and freeze/thaw cycles should be avoided.

What is the concentration and form of the rabbit anti-Doublecortin monoclonal antibody 9059 provided?

The antibody is supplied as a liquid at a concentration of 1 mg/mL, with a size of 100 µg.

What immunogen was used to generate the rabbit anti-Doublecortin monoclonal antibody 9059?

The immunogen is the recombinant full-length human Lis-A isoform of Doublecortin expressed in and purified from E. coli.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.