rabbit anti-Chromogranin A monoclonal antibody (ZR427) 6124

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to Chromogranin A
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Pancreas or neuroendocrine tumor
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6124parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Chromogranin A, Immunohistochemistry, monoclonal, Neuropathology/Endocrine

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-Chromogranin A monoclonal antibody ZR427 6124

antibody
Database link: human P10645
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Pancreas or neuroendocrine tumor
Immunogen Recombinant human Chromogranin A protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens CHGA Chromogranin-A
Protein names Chromogranin-A
Alternative names Pituitary secretory protein I
Gene names CHGA
Protein family Belongs to the chromogranin/secretogranin protein family
Function Strongly inhibits glucose induced insulin release from the pancreas
Subcellular location Cytoplasmic vesicle, secretory vesicle, Cytoplasmic vesicle, secretory vesicle, neuronal dense core vesicle, Secreted
Structure Self-interacts; self-assembly is promoted in vitro by chondroitin sulfate attachment which occurs at mildly acidic pH conditions (PubMed:25326458). Interacts with SCG3 (By similarity). Interacts with ITPR1 in the secretory granules (By similarity)
Post-translational modification Sulfated on tyrosine residues and/or contains sulfated glycans O-glycosylated with core 1 or possibly core 8 glycans (PubMed:19838169, PubMed:23234360, PubMed:9852066). Contains chondroitin sulfate (CS); CS attachment is pH-dependent, being observed at mildly acidic conditions of pH 5 but not at neutral pH, and promotes self-assembly in vitro (PubMed:25326458) Proteolytic processing gives rise to an additional longer form of catestatin (residues 358-390) which displays a less potent catecholamine release-inhibitory activity (PubMed:10781584). Plasmin-mediated proteolytic processing can give rise to additional shorter and longer forms of catestatin peptides (PubMed:17991725)
Keywords 3D-structure, Amidation, Antibiotic, Antimicrobial, Calcium, Cleavage on pair of basic residues, Cytoplasmic vesicle, Direct protein sequencing, Disulfide bond, Fungicide, Glycoprotein, Oxidation, Phosphoprotein, Proteoglycan, Proteomics identification, Reference proteome, Secreted, Signal, Sulfation
Sequence MRSAAVLALLLCAGQVTALPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETL RGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEA VEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESKAEGNNQAPGEEEEEEEEA TNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREKGLSAEPGWQAKREEEEEEEEEAEAG EEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHS QQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEG QEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKE EEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG
UniProt accession: P10645

Data

Human neuroendocrine tumor stained with anti-Chromogranin A antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic tumor cells.

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-Chromogranin A monoclonal antibody (ZR427) specifically react with?

This antibody specifically reacts with human tissues.

For which application is the rabbit anti-Chromogranin A monoclonal antibody (ZR427) validated and recommended?

It is validated and recommended for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

How should the rabbit anti-Chromogranin A monoclonal antibody be stored to maintain its stability?

Store the antibody at 2-8°C for short-term use and at -20°C for long-term storage, avoiding freeze/thaw cycles.

What is the recommended dilution range for using the concentrated form of this antibody in IHC?

The recommended dilution for the concentrated antibody is between 1:100 and 1:200 for immunohistochemistry applications.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.