Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human Ewing’s sarcoma stained with clone ZR423 antibody using peroxidase-conjugate and DAB chromogen. Note the cell membrane staining of tumor cells

rabbit anti-CD99 monoclonal antibody (ZR423) 6116

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to CD99
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Ewing’s sarcoma
Visualization: Cell membrane
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6116parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD99, Soft Tissue Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-CD99 monoclonal antibody ZR423 6116

antibody
Database link: human P14209
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Ewing's sarcoma
Immunogen Recombinant fragment (around aa1-185) of human MIC2 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens CD99 CD99 antigen
Protein names CD99 antigen
Alternative names 12E7, E2 antigen, Protein MIC2, T-cell surface glycoprotein E2
Gene names CD99
Protein family Belongs to the CD99 family
Function Involved in T-cell adhesion processes and in spontaneous rosette formation with erythrocytes. Plays a role in a late step of leukocyte extravasation helping leukocytes to overcome the endothelial basement membrane. Acts at the same site as, but independently of, PECAM1. Involved in T-cell adhesion processes (By similarity)
Subcellular location Membrane
Post-translational modification Extensively O-glycosylated
Keywords 3D-structure, Alternative splicing, Cell adhesion, Direct protein sequencing, Glycoprotein, Membrane, Phosphoprotein, Proteomics identification, Reference proteome, Signal, Transmembrane, Transmembrane helix
Sequence MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVV DGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEE ADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQR TLLEK
UniProt accession: P14209

Data

Formalin-fixed, paraffin-embedded human Ewing's sarcoma stained with clone ZR423 antibody using peroxidase-conjugate and DAB chromogen. Note the cell membrane staining of tumor cells

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-CD99 monoclonal antibody (ZR423) specifically react with?

This antibody is reactive with human tissue samples.

Which application is recommended for using the rabbit anti-CD99 monoclonal antibody (ZR423)?

It is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

How should the rabbit anti-CD99 monoclonal antibody be stored to maintain stability?

Store the antibody at 2-8°C for short-term use and at -20°C for longer-term storage, avoiding freeze/thaw cycles.

What is the recommended dilution range when using the concentrated form of this antibody in IHC?

The recommended dilution for the concentrated antibody is between 1:100 and 1:200.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.