Immunohistochemistry (IHC) : Human neuroendocrine carcinoma stained with anti-CD56 antibody using peroxidase-conjugate and DAB chromogen. Note cell membrane staining of tumor cells.

rabbit anti-CD56 monoclonal antibody (ZR421) 6103

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to CD56
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Neuroblastoma, neuroendocrine carcinoma
Visualization: Cell membrane
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6103parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD56, monoclonal, Neuropathology/Endocrine

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-CD56 monoclonal antibody ZR421 6103

antibody
Database link: human P13591
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Neuroblastoma, neuroendocrine carcinoma
Immunogen Recombinant fragment (around aa600-800) of human NCAM1 (CD56) protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens NCAM1 Neural cell adhesion molecule 1
Protein names Neural cell adhesion molecule 1
Gene names NCAM1
Function This protein is a cell adhesion molecule involved in neuron-neuron adhesion, neurite fasciculation, outgrowth of neurites, etc
Subcellular location Secreted
Structure Interacts with MDK. Found in a complex with SLC39A6, SLC39A10 and with NCAM1; this complex controls NCAM1 phosphorylation and integration into focal adhesion complexes during epithelial-tomesenchymal transition. Interacts with synaptic plasticity regulator PANTS
Post-translational modification Polysialylated at Asn-459 and Asn-488 by ST8SIA2 and ST8SIA4 (PubMed:28810663). Polysialylation modulates cell interactions by confering both attractive and repulsive properties that are highly regulated by ST8SIA2 and ST8SIA4 (PubMed:28810663). Polysialylation is formed on a-2,3-linked sialic acid of core glycans (PubMed:9774483)
Keywords 3D-structure, Alternative splicing, Cell adhesion, Cell membrane, Disulfide bond, Glycoprotein, GPI-anchor, Host cell receptor for virus entry, Host-virus interaction, Immunoglobulin domain, Lipoprotein, Membrane, Phosphoprotein, Proteomics identification, Receptor, Reference proteome, Repeat, Secreted, Signal, Transmembrane, Transmembrane helix
Sequence MLQTKDLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGE KLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMF KNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIK KTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGF PEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATI HLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPE KQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQG PVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDS ENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPI LKYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAA SEFKTQPVQGEPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEI RLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANGSPTSGLS TGAIVGILIVIFVLLLVVVDITCYFLNKCGLFMCIAVNLCGKAGPGAKGKDMEEGKAAFS KDESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVEAKPECQETETKPAPAE VKTVPNDATQTKENESKA
UniProt accession: P13591

Data

Human neuroendocrine carcinoma stained with anti-CD56 antibody using peroxidase-conjugate and DAB chromogen. Note cell membrane staining of tumor cells.

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-CD56 monoclonal antibody (ZR421) specifically react with?

This antibody is reactive with human tissues, making it suitable for applications involving human samples.

How should the rabbit anti-CD56 monoclonal antibody be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For longer-term storage, it should be kept at -20°C while avoiding freeze/thaw cycles to preserve antibody integrity.

Which application is the rabbit anti-CD56 monoclonal antibody (ZR421) validated for, and what are the recommended dilution factors?

This antibody has been tested and is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues. The recommended dilution for the concentrated antibody is between 1:100 and 1:200.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.