Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human squamous cell carcinoma stained with anti-CD44 using peroxidase-conjugate and DAB chromogen. Note the cell membrane staining of tumor cells

rabbit anti-CD44 monoclonal antibody (ZR184) 6095

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to CD44
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Colon carcinoma
Visualization: Cell membrane
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6095parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD44, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-CD44 monoclonal antibody ZR184 6095

antibody
Database link: human P16070
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Colon carcinoma
Immunogen Recombinant Human CD44 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens CD44 CD44 antigen
Protein names CD44 antigen
Alternative names CDw44, Epican, Extracellular matrix receptor III, GP90 lymphocyte homing/adhesion receptor, HUTCH-I, Heparan sulfate proteoglycan, Hermes antigen, Hyaluronate receptor, Phagocytic glycoprotein 1, Phagocytic glycoprotein I
Gene names CD44
Function Cell-surface receptor that plays a role in cell-cell interactions, cell adhesion and migration, helping them to sense and respond to changes in the tissue microenvironment (PubMed:16541107, PubMed:19703720, PubMed:22726066). Participates thereby in a wide variety of cellular functions including the activation, recirculation and homing of T-lymphocytes, hematopoiesis, inflammation and response to bacterial infection (PubMed:7528188). Engages, through its ectodomain, extracellular matrix components such as hyaluronan/HA, collagen, growth factors, cytokines or proteases and serves as a platform for signal transduction by assembling, via its cytoplasmic domain, protein complexes containing receptor kinases and membrane proteases (PubMed:18757307, PubMed:23589287). Such effectors include PKN2, the RhoGTPases RAC1 and RHOA, Rho-kinases and phospholipase C that coordinate signaling pathways promoting calcium mobilization and actin-mediated cytoskeleton reorganization essential for cell migration and adhesion (PubMed:15123640). Upon interaction with LGALS9 ligand, activates downstream signaling components including LCK, ERK and MAPK to promotes NK cell activation (PubMed:37006235)
Subcellular location Cell membrane, Cell projection, microvillus, Secreted
Structure (Microbial infection) Interacts with foot-and-mouth disease virus protein VP3; this interaction allows FMDV entry into host cell via macropinocytosis
Post-translational modification Proteolytically cleaved in the extracellular matrix by specific proteinases (possibly MMPs) in several cell lines and tumors N-glycosylated O-glycosylated; contains chondroitin sulfate glycans which can be more or less sulfated and whose number may affect the accessibility of specific proteinases to their cleavage site(s). It is uncertain if O-glycosylation occurs on Thr-637 or Thr-638 Phosphorylated; activation of PKC results in the dephosphorylation of Ser-706 (constitutive phosphorylation site), and the phosphorylation of Ser-672
Keywords 3D-structure, Alternative splicing, Blood group antigen, Cell adhesion, Cell membrane, Cell projection, Direct protein sequencing, Disulfide bond, Glycoprotein, Membrane, Phosphoprotein, Proteoglycan, Proteomics identification, Receptor, Reference proteome, Secreted, Signal, Transmembrane, Transmembrane helix
Sequence MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTL PTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFN ASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSS GSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQE TWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNEENEDERDRHLSFSGSGIDDD EDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWN PEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDS HSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSIT LQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDV TGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNR SLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLAL ALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSET PDQFMTADETRNLQNVDMKIGV
UniProt accession: P16070

Data

Formalin-fixed, paraffin-embedded human squamous cell carcinoma stained with anti-CD44 using peroxidase-conjugate and DAB chromogen. Note the cell membrane staining of tumor cells

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-CD44 monoclonal antibody (ZR184) specifically react with?

This antibody specifically reacts with human CD44 antigen.

What are the recommended storage conditions to maintain the stability of the rabbit anti-CD44 monoclonal antibody (ZR184)?

For short term storage, keep the antibody at 2-8°C. For longer term storage, it should be kept at -20°C while avoiding repeated freeze/thaw cycles.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.