| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Caspase-10 (CT) |
| available sizes | 100 µg |
rabbit anti-Caspase-10 (CT) polyclonal antibody 3094
$445.00
Antibody summary
- Rabbit polyclonal to Caspase-10 (CT)
- Suitable for: ELISA,WB,IF,ICC
- Isotype: IgG
- 100 µg
rabbit anti-Caspase-10 (CT) polyclonal antibody 3094
| antibody |
|---|
| Tested applications WB,IHC,IHC,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting: use at 1ug/mL. These are recommended concentrations. Enduser should determine optimal concentrations for their applications. Positive control: Whole cell lysate from HeLa cells. |
| Immunogen Peptide corresponding to aa 505-521 at C-terminus of human FLICE2 (accession no. AAD28402). |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens CASP10 Caspase-10 |
| Protein names Caspase-10 |
| Alternative names Apoptotic protease Mch-4, FAS-associated death domain protein interleukin-1B-converting enzyme 2, ICE-like apoptotic protease 4 |
| Gene names CASP10 |
| Protein family Belongs to the peptidase C14A family |
| Function Involved in the activation cascade of caspases responsible for apoptosis execution. Recruited to both Fas- and TNFR-1 receptors in a FADD dependent manner. May participate in the granzyme B apoptotic pathways. Cleaves and activates effector caspases CASP3, CASP4, CASP6, CASP7, CASP8 and CASP9. Hydrolyzes the small- molecule substrates, Tyr-Val-Ala-Asp-|-AMC and Asp-Glu-Val-Asp-|-AMC |
| Catalytic activity Strict requirement for Asp at position P1 and has a preferred cleavage sequence of Leu-Gln-Thr-Asp-|-Gly. |
| Structure Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a 23/17 kDa (p23/17) (depending on the splicing events) and a 12 kDa (p12) subunit (By similarity). Self-associates. Interacts with FADD and CASP8. Found in a Fas signaling complex consisting of FAS, FADD, CASP8 and CASP10. Interacts with RFFL and RNF34; negatively regulate CASP10 through proteasomal degradation. Interacts with RIOK3 |
| Post-translational modification Cleavage by granzyme B and autocatalytic activity generate the two active subunits |
| Involvement in disease Autoimmune lymphoproliferative syndrome 2A A disorder of apoptosis that manifests in early childhood and results in the accumulation of autoreactive lymphocytes. It is characterized by non-malignant lymphadenopathy with hepatosplenomegaly, and autoimmune hemolytic anemia, thrombocytopenia and neutropenia. Familial non-Hodgkin lymphoma Cancer that starts in cells of the lymph system, which is part of the body's immune system. NHLs can occur at any age and are often marked by enlarged lymph nodes, fever and weight loss. Gastric cancer A malignant disease which starts in the stomach, can spread to the esophagus or the small intestine, and can extend through the stomach wall to nearby lymph nodes and organs. It also can metastasize to other parts of the body. The term gastric cancer or gastric carcinoma refers to adenocarcinoma of the stomach that accounts for most of all gastric malignant tumors. Two main histologic types are recognized, diffuse type and intestinal type carcinomas. Diffuse tumors are poorly differentiated infiltrating lesions, resulting in thickening of the stomach. In contrast, intestinal tumors are usually exophytic, often ulcerating, and associated with intestinal metaplasia of the stomach, most often observed in sporadic disease. |
| Keywords Alternative splicing, Apoptosis, Direct protein sequencing, Disease variant, Hydrolase, Protease, Proteomics identification, Reference proteome, Repeat, Thiol protease, Zymogen |
| Sequence MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASD VFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLLPTRQRVSLFRNLLY ELSEGIDSENLKDMIFLLKDSLPKTEMTSLSFLAFLEKQGKIDEDNLTCLEDLCKTVVPK LLRNIEKYKREKAIQIVTPPVDKEAESYQGEEELVSQTDVKTFLEALPQESWQNKHAGSN GNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDR QGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGR FGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPE QAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRMLKFLEKT MEIRGRKRTVWGAKQISATSLPTAISAQTPRPPMRRWSSVS |
| UniProt accession: Q92851 |
Data
 |
| Western blot analysis of caspase-10 in HeLa (H), Jurkat (J), A431 (A), K562 (K) whole cell lysates with Caspase-10 antibody at 1 µg/mL. |
 |
| Immunofluorescence of Casp10 in Hela cells with Caspase 10 antibody at 20 µg/mL.
Green: Caspase-10 Antibody (3094) Blue: DAPI staining |
 |
| Immunocytochemistry of Casp10 in Hela cells with Caspase 10 antibody at 5 µg/mL. |
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-Caspase-10 (CT) polyclonal antibody suitable for?
This antibody is suitable for ELISA, Western blotting (WB), immunofluorescence (IF), and immunocytochemistry (ICC). Recommended use includes immunoblotting at 1 µg/mL concentration.
How should the rabbit anti-Caspase-10 (CT) polyclonal antibody be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is recommended to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the immunogen used to generate this rabbit anti-Caspase-10 (CT) polyclonal antibody?
The immunogen is a peptide corresponding to amino acids 505-521 at the C-terminus of human FLICE2 (Caspase-10), based on the accession number AAD28402.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.