Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded normal human breast tissue stained with anti-caldesmon antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of myoepithelial cells

rabbit anti-Caldesmon monoclonal antibody (ZR413) 6047

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to Caldesmon
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Uterus, colon carcinoma
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6047parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Caldesmon, Soft Tissue Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-Caldesmon monoclonal antibody ZR413 6047

antibody
Database link: human Q05682
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Uterus, colon carcinoma
Immunogen Recombinant full-length human CALD1 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens CALD1 Caldesmon
Protein names Caldesmon
Gene names CALD1
Protein family Belongs to the caldesmon family
Function Actin- and myosin-binding protein implicated in the regulation of actomyosin interactions in smooth muscle and nonmuscle cells (could act as a bridge between myosin and actin filaments). Stimulates actin binding of tropomyosin which increases the stabilization of actin filament structure. In muscle tissues, inhibits the actomyosin ATPase by binding to F-actin. This inhibition is attenuated by calcium-calmodulin and is potentiated by tropomyosin. Interacts with actin, myosin, two molecules of tropomyosin and with calmodulin. Also plays an essential role during cellular mitosis and receptor capping. Involved in Schwann cell migration during peripheral nerve regeneration (By similarity)
Subcellular location Cytoplasm, cytoskeleton, Cytoplasm, myofibril, Cytoplasm, cytoskeleton, stress fiber
Post-translational modification In non-muscle cells, phosphorylation by CDK1 during mitosis causes caldesmon to dissociate from microfilaments. Phosphorylation reduces caldesmon binding to actin, myosin, and calmodulin as well as its inhibition of actomyosin ATPase activity. Phosphorylation also occurs in both quiescent and dividing smooth muscle cells with similar effects on the interaction with actin and calmodulin and on microfilaments reorganization. CDK1-mediated phosphorylation promotes Schwann cell migration during peripheral nerve regeneration (By similarity)
Keywords Actin-binding, Alternative splicing, Calmodulin-binding, Cytoplasm, Cytoskeleton, Isopeptide bond, Muscle protein, Phosphoprotein, Proteomics identification, Reference proteome, Repeat, Ubl conjugation
Sequence MDDFERRRELRRQKREEMRLEAERIAYQRNDDDEEEAARERRRRARQERLRQKQEEESLG QVTDQVEVNAQNSVPDEEAKTTTTNTQVEGDDEAAFLERLARREERRQKRLQEALERQKE FDPTITDASLSLPSRRMQNDTAENETTEKEEKSESRQERYEIEETETVTKSYQKNDWRDA EENKKEDKEKEEEEEEKPKRGSIGENQVEVMVEEKTTESQEETVVMSLKNGQISSEEPKQ EEEREQGSDEISHHEKMEEEDKERAEAERARLEAEERERIKAEQDKKIADERARIEAEEK AAAQERERREAEERERMREEEKRAAEERQRIKEEEKRAAEERQRIKEEEKRAAEERQRIK EEEKRAAEERQRARAEEEEKAKVEEQKRNKQLEEKKHAMQETKIKGEKVEQKIEGKWVNE KKAQEDKLQTAVLKKQGEEKGTKVQAKREKLQEDKPTFKKEEIKDEKIKKDKEPKEEVKS FMDRKKGFTEVKSQNGEFMTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELR RRRGETESEEFEKLKQKQQEAALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEE KRRLKEEIERRRAEAAEKRQKMPEDGLSDDKKPFKCFTPKGSSLKIEERAEFLNKSVQKS SGVKSTHQAAIVSKIDSRLEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNIKSMWEKGN VFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWE KQSVDKVTSPTKV
UniProt accession: Q05682

Data

Formalin-fixed, paraffin-embedded normal human breast tissue stained with anti-caldesmon antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of myoepithelial cells

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-Caldesmon monoclonal antibody (ZR413) react with?

This antibody specifically reacts with human Caldesmon protein.

Which applications is the rabbit anti-Caldesmon monoclonal antibody (ZR413) validated for?

It is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

What are the recommended storage conditions for this antibody to maintain stability?

For short-term storage, keep the antibody at 2-8°C; for longer-term storage, it should be kept at -20°C while avoiding repeated freeze/thaw cycles.

What is the immunogen used to generate the rabbit anti-Caldesmon monoclonal antibody (ZR413)?

The antibody was raised against recombinant full-length human CALD1 protein.

What is the clonality and isotype of this anti-Caldesmon antibody?

It is a rabbit monoclonal antibody of the IgG isotype.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.