Skip to content

rabbit anti-AMPK α 1 polyclonal antibody 9481

$518.00

Antibody summary

  • Rabbit polyclonal to AMPK α 1
  • Suitable for: WB,IP,IHC
  • Isotype: Whole IgG
  • 100 µg
SKU: 9481parent Categories: , Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

rabbit

isotype

IgG

clonality

polyclonal

concentration

1 mg/mL

applications

ICC/IF, WB

reactivity

AMPKα 1

available sizes

100 µg

rabbit anti-AMPK α 1 polyclonal antibody 9481

antibody
Tested applications
WB,IHC,IHC,IP
Recommended dilutions
Immunoblotting: use at 0.2-2ug/mL

Immunohistochemistry: use at 0.2- 2ug/mL.
Immunogen
Synthetic peptide representing a portion of the protein encoded within exon 8.
Size and concentration
100µg and lot specific
Form
liquid
Storage Instructions
This antibody is stable at 2-8°C for 1 year.
Storage buffer
Tris-citrate/phosphate buffer, pH 7 to 8 contai
Purity
immunogen affinity purification
Clonality
polyclonal
Isotype
IgG
Compatible secondaries
goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863
goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control
Rabbit polyclonal - Isotype Control
target relevance
Homo sapiens PRKAA1
5'-AMP-activated protein kinase catalytic subunit alpha-1
Protein names
5'-AMP-activated protein kinase catalytic subunit alpha-1
Alternative names
Acetyl-CoA carboxylase kinase, Hydroxymethylglutaryl-CoA reductase kinase, Tau-protein kinase PRKAA1
Gene names
PRKAA1
Protein family
Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. SNF1 subfamily
Function
Catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism (PubMed:17307971, PubMed:17712357, PubMed:24563466, PubMed:31492851, PubMed:37821951, PubMed:40233740). In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation (PubMed:17307971, PubMed:17712357). AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators (PubMed:17307971, PubMed:17712357). Regulates lipid synthesis by phosphorylating and inactivating lipid metabolic enzymes such as ACACA, ACACB, GYS1, HMGCR and LIPE; regulates fatty acid and cholesterol synthesis by phosphorylating acetyl-CoA carboxylase (ACACA and ACACB) and hormone-sensitive lipase (LIPE) enzymes, respectively (By similarity). Promotes lipolysis of lipid droplets by mediating phosphorylation of isoform 1 of CHKA (CHKalpha2) (PubMed:34077757). Regulates insulin-signaling and glycolysis by phosphorylating IRS1, PFKFB2 and PFKFB3 (By similarity). AMPK stimulates glucose uptake in muscle by increasing the translocation of the glucose transporter SLC2A4/GLUT4 to the plasma membrane, possibly by mediating phosphorylation of TBC1D4/AS160 (By similarity). Regulates transcription and chromatin structure by phosphorylating transcription regulators involved in energy metabolism such as CRTC2/TORC2, FOXO3, histone H2B, HDAC5, MEF2C, MLXIPL/ChREBP, EP300, HNF4A, p53/TP53, SREBF1, SREBF2 and PPARGC1A (PubMed:11518699, PubMed:11554766, PubMed:15866171, PubMed:17711846, PubMed:18184930). Acts as a key regulator of glucose homeostasis in liver by phosphorylating CRTC2/TORC2, leading to CRTC2/TORC2 sequestration in the cytoplasm (By similarity). In response to stress, phosphorylates 'Ser-36' of histone H2B (H2BS36ph), leading to promote transcription (By similarity). Acts as a key regulator of cell growth and proliferation by phosphorylating FNIP1, TSC2, RPTOR, WDR24 and ATG1/ULK1: in response to nutrient limitation, negatively regulates the mTORC1 complex by phosphorylating RPTOR component of the mTORC1 complex and by phosphorylating and activating TSC2 (PubMed:14651849, PubMed:18439900, PubMed:20160076, PubMed:21205641). Also phosphorylates and inhibits GATOR2 subunit WDR24 in response to nutrient limitation, leading to suppress glucose-mediated mTORC1 activation (PubMed:36732624). In response to energetic stress, phosphorylates FNIP1, inactivating the non-canonical mTORC1 signaling, thereby promoting nuclear translocation of TFEB and TFE3, and inducing transcription of lysosomal or autophagy genes (PubMed:37079666). In response to nutrient limitation, promotes autophagy by phosphorylating and activating ATG1/ULK1 (PubMed:21205641). In that process, it also activates WDR45/WIPI4 (PubMed:28561066). Phosphorylates CASP6, thereby preventing its autoprocessing and subsequent activation (PubMed:32029622). In response to nutrient limitation, phosphorylates transcription factor FOXO3 promoting FOXO3 mitochondrial import (By similarity). Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin (PubMed:17486097). AMPK also acts as a regulator of circadian rhythm by mediating phosphorylation of CRY1, leading to destabilize it (By similarity). May regulate the Wnt signaling pathway by phosphorylating CTNNB1, leading to stabilize it (By similarity). Also has tau-protein kinase activity: in response to amyloid beta A4 protein (APP) exposure, activated by CAMKK2, leading to phosphorylation of MAPT/TAU; however the relevance of such data remains unclear in vivo (By similarity). Also phosphorylates CFTR, EEF2K, KLC1, NOS3 and SLC12A1 (PubMed:12519745, PubMed:20074060). Regulates hepatic lipogenesis. Activated via SIRT3, represses sterol regulatory element-binding protein (SREBP) transcriptional activities and ATP-consuming lipogenesis to restore cellular energy balance. Upon stress, regulates mitochondrial fragmentation through phosphorylation of MTFR1L (PubMed:36367943). Phosphorylates ALDH7A1 in response to cellular stress, such as hypoxia or ferroptotic stress, promoting ALDH7A1 recruitment to membranes (PubMed:31492851, PubMed:40233740)
Catalytic activity
L-seryl-[protein] + ATP = O-phospho-L-seryl-[protein] + ADP + H(+)
L-threonyl-[protein] + ATP = O-phospho-L-threonyl-[protein] + ADP + H(+)
L-seryl-[acetyl-CoA carboxylase] + ATP = O-phospho-L-seryl-[acetyl-CoA carboxylase] + ADP + H(+)
L-seryl-[3-hydroxy-3-methylglutaryl-coenzyme A reductase] + ATP = O-phospho-L-seryl-[3-hydroxy-3-methylglutaryl-coenzyme A reductase] + ADP + H(+)
L-seryl-[tau protein] + ATP = O-phospho-L-seryl-[tau protein] + ADP + H(+)
L-threonyl-[tau protein] + ATP = O-phospho-L-threonyl-[tau protein] + ADP + H(+)
Subcellular location
Cytoplasm, Nucleus
Structure
(Microbial infection) Interacts with Dengue type 2 virus non-structural protein 1; this interaction promotes the AMPK/ERK/mTOR signaling pathway to induce autophagy
Post-translational modification
Ubiquitinated
Phosphorylated at Thr-183 by STK11/LKB1 in complex with STE20-related adapter-alpha (STRADA) pseudo kinase and CAB39. Also phosphorylated at Thr-183 by CAMKK2; triggered by a rise in intracellular calcium ions, without detectable changes in the AMP/ATP ratio. CAMKK1 can also phosphorylate Thr-183, but at a much lower level. Dephosphorylated by protein phosphatase 2A and 2C (PP2A and PP2C). Phosphorylated by ULK1 and ULK2; leading to negatively regulate AMPK activity and suggesting the existence of a regulatory feedback loop between ULK1, ULK2 and AMPK. Dephosphorylated by PPM1A and PPM1B
Glycosylated; O-GlcNAcylated by OGT, promoting the AMP-activated protein kinase (AMPK) activity
Keywords
3D-structure, Alternative splicing, ATP-binding, Autophagy, Biological rhythms, Cholesterol biosynthesis, Cholesterol metabolism, Chromatin regulator, Cytoplasm, Fatty acid biosynthesis, Fatty acid metabolism, Glycoprotein, Host-virus interaction, Kinase, Lipid biosynthesis, Lipid metabolism, Magnesium, Metal-binding, Nucleotide-binding, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Serine/threonine-protein kinase, Steroid biosynthesis, Steroid metabolism, Sterol biosynthesis, Sterol metabolism, Transcription, Transcription regulation, Transferase, Ubl conjugation, Wnt signaling pathway
Sequence
MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG RLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEF LRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDG IFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID DEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS FLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDI MAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDE ITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPG SHTIEFFEMCANLIKILAQ
UniProt accession: Q13131

Data

benchmark-antibodies_anti-ampkalpha_1_antibody_9481_1.jpg
Detection of human AMPK alpha 1 by immunohistochemistry. Sample: FFPE section of human smooth muscle. Antibody: Affinity purified rabbit anti-AMPK alpha 1 (Cat. No. 9481 Lot 3) used at a dilution of 1:1,000 ( 1µg /ml). Detection: DAB
benchmark-antibodies_anti-ampkalpha_1_antibody_9481_2.jpg
Detection of human AMPK alpha 1 by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-AMPK alpha 1 antibody 9481 (lot 9481-3) used for IP at 3 µg per reaction. AMPK alpha 1 was also immunoprecipitated by a previous lot of this antibody (lot 9481-2). For blotting immunoprecipitated AMPK alpha 1, 9481 was used at 0.4 µg /ml. Detection: Chemiluminescence with an exposure time of 3 seconds.
benchmark-antibodies_anti-ampkalpha_1_antibody_9481_3.jpg
Detection of human and mouse AMPK alpha 1 by western blot. Samples: Whole cell lysate (15 µg ) from HeLa, HEK293T, Jurkat, mouse TCMK-1, and mouse NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-AMPK alpha 1 antibody 9481 (lot 9481-3) used for WB at 0.1 µg /ml. Detection: Chemiluminescence with an exposure time of 3 seconds.

FAQ & Publications

Frequently Asked Questions
What applications has the rabbit anti-AMPK α 1 polyclonal antibody 9481 been validated for?
The antibody has been tested and validated for use in Western blotting (WB), immunoprecipitation (IP), and immunohistochemistry (IHC). Recommended dilutions for immunoblotting and immunohistochemistry range from 0.2 to 2 µg/mL.
How should the rabbit anti-AMPK α 1 polyclonal antibody 9481 be stored to maintain stability?
This antibody is stable when stored at 2-8°C for up to one year. It is supplied in a liquid form with a Tris-citrate/phosphate buffer at pH 7 to 8.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
Western blot
IHC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.