Immunohistochemistry (IHC) : Human prostate carcinoma stained anti-AMACR, anti-p63 and anti-HMW CK 34βE12 antibodies using peroxidase-conjugate and DAB chromogens. Note cytoplasmic and luminal circumferential staining of carcinoma glands with AMACR and basal cell staining with p63 and HMW CK 34βE12.

rabbit anti-AMACR + p63 + HMW CK Cocktail monoclonal antibody (13H4 + ZM70 + 34βE12) 6021

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to AMACR + p63 + HMW CK Cocktail
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG, IgG1 + IgG2a
Control: Prostate intraepithelial neoplasia (PIN)
Visualization: Cytoplasmic and nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6021parent Categories: antibody, Zeta IHC antibodies Tags: AMACR, anatomy, HMW CK, p63, Urinary Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG, IgG1 + IgG2a
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-AMACR + p63 + HMW CK Cocktail monoclonal antibody 13H4 + ZM70 + 34βE12 6021

antibody
Database link: human Q9UHK6 human Q9H3D4
Tested applications IHC
Recommended dilutions Concentrated 1:50
Application Notes Positive control: Prostate intraepithelial neoplasia (PIN)
Immunogen Human AMACR (P504S) , p63, and CKHMW (34betaE12) polypeptides
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens AMACR Alpha-methylacyl-CoA racemase
Protein names Alpha-methylacyl-CoA racemase
Alternative names 2-methylacyl-CoA racemase
Gene names AMACR
Protein family Belongs to the CoA-transferase III family
Function Catalyzes the interconversion of (R)- and (S)-stereoisomers of alpha-methyl-branched-chain fatty acyl-CoA esters (PubMed:10655068, PubMed:11060359, PubMed:7649182). Acts only on coenzyme A thioesters, not on free fatty acids, and accepts as substrates a wide range of alpha-methylacyl-CoAs, including pristanoyl-CoA, trihydroxycoprostanoyl-CoA (an intermediate in bile acid synthesis), and arylpropionic acids like the anti-inflammatory drug ibuprofen (2-(4-isobutylphenyl)propionic acid) but neither 3-methyl-branched nor linear-chain acyl-CoAs (PubMed:10655068, PubMed:11060359, PubMed:7649182)
Catalytic activity a (2S)-2-methylacyl-CoA = a (2R)-2-methylacyl-CoA (25R)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oyl-CoA = (25S)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oyl-CoA (2R,6)-dimethylheptanoyl-CoA = (2S,6)-dimethylheptanoyl-CoA
Subcellular location Peroxisome, Mitochondrion
Structure Monomer
Involvement in disease Alpha-methylacyl-CoA racemase deficiency A rare autosomal recessive peroxisomal disorder characterized by elevated plasma concentrations of pristanic acid C27-bile-acid intermediates, and adult onset of variable neurodegenerative symptoms affecting the central and peripheral nervous systems. Features may include seizures, visual failure, sensorimotor neuropathy, spasticity, migraine, and white matter hyperintensities on brain imaging. Congenital bile acid synthesis defect 4 A disorder characterized by the presence of trihydroxycoprostanic acid in the bile and absence of cholic acid. Patients manifest neonatal jaundice, intrahepatic cholestasis and bile duct deficiency.
Keywords Acetylation, Alternative splicing, Disease variant, Intrahepatic cholestasis, Isomerase, Mitochondrion, Peroxisome, Proteomics identification, Reference proteome
Sequence MALQGISVVELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQP RGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLA GHDINYLALSGVLSKIGRSGENPYAPLNLLADFAGGGLMCALGIIMALFDRTRTGKGQVI DANMVEGTAYLSSFLWKTQKLSLWEAPRGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQF YELLIKGLGLKSDELPNQMSMDDWPEMKKKFADVFAEKTKAEWCQIFDGTDACVTPVLTF EEVVHHDHNKERGSFITSEEQDVSPRPAPLLLNTPAIPSFKRDPFIGEHTEEILEEFGFS REEIYQLNSDKIIESNKVKASL
UniProt accession: Q9UHK6

Data

Human prostate carcinoma stained anti-AMACR, anti-p63 and anti-HMW CK 34 E12 antibodies using peroxidase-conjugate and DAB chromogens. Note cytoplasmic and luminal circumferential staining of carcinoma glands with AMACR and basal cell staining with p63 and HMW CK 34 E12.

FAQ & Publications

Frequently Asked Questions

What species is the rabbit anti-AMACR + p63 + HMW CK Cocktail monoclonal antibody reactive with?

This antibody cocktail is reactive with human tissues.

Which applications is this antibody cocktail validated for?

It is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissue sections.

How should the rabbit anti-AMACR + p63 + HMW CK Cocktail antibody be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be stored at -20°C, avoiding freeze/thaw cycles.

What is the recommended dilution for using the concentrated form of this antibody in IHC?

The recommended dilution for the concentrated antibody is 1:50 for immunohistochemistry applications.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.