| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| target | Pig TRY (Trypsin) |
| species reactivity | pig |
| applications | sandwich (sELISA) |
| assay type | direct & quantitative |
| available size | 96 tests |
| sensitivity | 0.938 ng/ml |
| range | 1.563–100 ng/ml |
Pig TRY (Trypsin) ELISA Kit 60803
$570.00
Summary
- ELISA kit for research use (RUO)
- Reactivity: Pig trypsin
- Suitable for: ELISA
- Time:3 hours
- Sample types: Serum, plasma, tissue homogenates and other biological fluids
Pig TRY (Trypsin) ELISA Kit
| kit | ||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Assay type sandwich (sELISA) | ||||||||||||||||||||||
| Research area host cell protein | ||||||||||||||||||||||
| Sample type Serum, plasma, tissue homogenates and other biological fluids | ||||||||||||||||||||||
Components
| ||||||||||||||||||||||
| Storage Store at 2-8°C. |
| target relevance |
|---|
| Sus scrofa TRYP Trypsin |
| Protein names Trypsin |
| Protein family Belongs to the peptidase S1 family |
| Catalytic activity Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa. |
| Subcellular location Secreted, extracellular space |
| Keywords 3D-structure, Calcium, Digestion, Direct protein sequencing, Disulfide bond, Hydrolase, Metal-binding, Protease, Reference proteome, Secreted, Serine protease, Zymogen |
| Sequence FPTDDDDKIVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGE HNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAA GTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDS CQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN |
| UniProt accession: P00761 |
Data
Standard Curve
X axis: log |
Y axis: linear
| Standard | STD [ng/mL] | OD1 | OD2 | Average OD | Corrected OD |
|---|---|---|---|---|---|
| Blank #8 | 0 | 0.12 | 0.13 | 0.13 | 0 |
| Standard #7 | 1.56 | 0.2 | 0.21 | 0.2 | 0.08 |
| Standard #6 | 3.13 | 0.35 | 0.37 | 0.36 | 0.23 |
| Standard #5 | 6.25 | 0.51 | 0.54 | 0.53 | 0.4 |
| Standard #4 | 12.5 | 0.71 | 0.75 | 0.73 | 0.6 |
| Standard #3 | 25 | 1.08 | 1.14 | 1.11 | 0.98 |
| Standard #2 | 50 | 1.62 | 1.7 | 1.66 | 1.54 |
| Standard #1 | 100 | 2.06 | 2.17 | 2.11 | 1.99 |
Precision
| Sample | n | Mean | Standard Deviation | CV (%) |
|---|---|---|---|---|
| Intra Sample 1 | 20 | 3.16 | 0.17 | 5.23 |
| Inter Sample 1 | 20 | 3.23 | 0.16 | 4.89 |
| Intra Sample 2 | 20 | 13.74 | 0.64 | 4.68 |
| Inter Sample 2 | 20 | 13.32 | 0.64 | 4.82 |
| Intra Sample 3 | 20 | 49.3 | 2.57 | 5.22 |
| Inter Sample 3 | 20 | 50.61 | 3.39 | 6.7 |
Recovery
| Matrix | Recovery Range (%) | Average (%) |
|---|---|---|
| Serum(n=5) | 89-101 | 94 |
| EDTA Plasma(n=5) | 86-105 | 96 |
| HeparinPlasma(n=5) | 85-105 | 97 |
Stability
| 37°C 1 Month (%) | 2–8°C 6 Months (%) | 2–8°C 12 Months (%) |
|---|---|---|
| 80 | 95-100 | 85-98 |
Linearity
| Sample | 1:2 Dilution (%) | 1:4 Dilution (%) | 1:8 Dilution (%) |
|---|---|---|---|
| Serum(n=5) | 88-97% | 83-101% | 80-96% |
| EDTAPlasma(n=5) | 89-104% | 92-95% | 80-100% |
| Heparin Plasma(n=5) | 86-101% | 83-100% | 80-95% |
FAQ & Publications
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| Relevant to this product |
|---|
| View Protocol | View PDF |
Documents
| # | ||
|---|---|---|
| Please enter your product and batch number here. | ||
Only logged in customers who have purchased this product may leave a review.














Reviews
There are no reviews yet.