OVA (Ovalbumin) ELISA Kit 60806

$570.00

Summary

ELISA kit for research use (RUO)
Reactivity: OVA (ovalbumin)
Suitable for: ELISA
Time:3 hours
Sample types: Serum, plasma, tissue homogenates and other biological fluids

SKU: 60806 Category: sELISA Tags: HCP, OVA (Ovalbumin), sandwich (sELISA)

Weight	1 lbs
Dimensions	9 × 5 × 2 in
target	OVA (Ovalbumin)
species reactivity	chicken
applications	sandwich (sELISA)
assay type	direct & quantitative
available size	96 tests
sensitivity	0.469 ng/ml
range	0.781–50 ng/ml

OVA (Ovalbumin) ELISA Kit

Assay type
sandwich (sELISA)

Research area
host cell protein

Sample type
Serum, plasma, tissue homogenates and other biological fluids

Components

Break apart microtiter test strips each coated single wells	8 x 12 (96 Total)
Lyophilized Standard	2 x vial
Biotin-labeled Antibody(Concentrated, 100X)	120 uL
HRP-Streptavidin Conjugate(Concentrated, 100X)	120 uL
Washing solution concentrate (25X)	30 mL
Sample Dilution buffer	20 mL
Antibody Dilution buffer	10 mL
Streptavidin Dilution buffer	10 mL
Stopping solution	10 mL
TMB Substrate (ready-to-use)	10 mL
Plate seals	3

Storage
Store at 2-8°C.

target relevance
Gallus gallus SERPINB14 Ovalbumin
Protein names Ovalbumin
Alternative names Allergen Gal d II, Egg albumin, Plakalbumin
Gene names SERPINB14
Protein family Belongs to the serpin family. Ov-serpin subfamily
Function Non-inhibitory serpin. Storage protein of egg white
Subcellular location Secreted
Structure Homodimer
Post-translational modification Undergoes proteolytic cleavage first at the canonical P1-P1' site, and then at the P8-P7 site by subtilisin
Keywords 3D-structure, Acetylation, Allergen, Calcium, Direct protein sequencing, Disulfide bond, Glycoprotein, Metal-binding, Phosphoprotein, Reference proteome, Secreted, Signal
Sequence MGSIGAASMEFCFDVFKELKVHHANENIFYCPIAIMSALAMVYLGAKDSTRTQINKVVRF DKLPGFGDSIEAQCGTSVNVHSSLRDILNQITKPNDVYSFSLASRLYAEERYPILPEYLQ CVKELYRGGLEPINFQTAADQARELINSWVESQTNGIIRNVLQPSSVDSQTAMVLVNAIV FKGLWEKAFKDEDTQAMPFRVTEQESKPVQMMYQIGLFRVASMASEKMKILELPFASGTM SMLVLLPDEVSGLEQLESIINFEKLTEWTSSNVMEERKIKVYLPRMKMEEKYNLTSVLMA MGITDVFSSSANLSGISSAESLKISQAVHAAHAEINEAGREVVGSAEAGVDAASVSEEFR ADHPFLFCIKHIATNAVLFFGRCVSP
UniProt accession: P01012

Data

Standard Curve

X axis: log | Y axis: linear

Standard	STD [ng/mL]	OD1	OD2	Average OD	Corrected OD
Blank #8	0	0.09	0.09	0.09	0
Standard #7	0.78	0.36	0.38	0.37	0.28
Standard #6	1.56	0.68	0.72	0.7	0.61
Standard #5	3.13	0.91	0.95	0.93	0.84
Standard #4	6.25	1.18	1.24	1.21	1.13
Standard #3	12.5	1.54	1.62	1.58	1.49
Standard #2	25	1.96	2.06	2.01	1.92
Standard #1	50	2.31	2.43	2.37	2.28

Precision

Sample	n	Mean	Standard Deviation	CV (%)
Intra Sample 1	20	1.46	0.09	5.99
Inter Sample 1	20	1.65	0.09	5.62
Intra Sample 2	20	5.81	0.28	4.81
Inter Sample 2	20	6.11	0.34	5.5
Intra Sample 3	20	25.11	1.16	4.62
Inter Sample 3	20	25.67	1.26	4.89

Recovery

Matrix	Recovery Range (%)	Average (%)
Serum(n=5)	86-99	91
EDTA Plasma(n=5)	85-101	94
Heparin Plasma(n=5)	88-105	98

Stability

37°C 1 Month (%)	2–8°C 6 Months (%)	2–8°C 12 Months (%)
80	95-100	85-98

Linearity

Sample	1:2 Dilution (%)	1:4 Dilution (%)	1:8 Dilution (%)
Serum(n=5)	88-101%	83-101%	81-95%
EDTA Plasma(n=5)	85-102%	87-100%	90-100%
Heparin Plasma(n=5)	85-101%	82-93%	82-91%

FAQ & Publications

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.