Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human tonsil stained with anti-PD-1 antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of T-cells

mouse anti-PD-1 (PDCD1) monoclonal antibody (ZM357) 6326

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to PD-1 (PDCD1)
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Lymph node
Visualization: Cytoplasm & Membrane
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6326parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, General & Epithelial Markers, PD-1 (PDCD1)

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-PD-1 (PDCD1) monoclonal antibody ZM357 6326

antibody
Database link: human Q15116
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Lymph node
Immunogen Recombinant fragment (around aa1-200) of human PDCD1 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens PDCD1 Programmed cell death protein 1
Protein names Programmed cell death protein 1
Gene names PDCD1
Function Inhibitory receptor on antigen activated T-cells that plays a critical role in induction and maintenance of immune tolerance to self (PubMed:21276005, PubMed:31754127, PubMed:32184441, PubMed:37208329). Delivers inhibitory signals upon binding to ligands CD274/PDCD1L1 and CD273/PDCD1LG2 (PubMed:21276005, PubMed:26602187). Following T-cell receptor (TCR) engagement, PDCD1 associates with TCR-CD3 in the immunological synapse and directly inhibits T-cell activation (PubMed:32184441). Suppresses T-cell activation through the recruitment of PTPN11/SHP-2: following ligand-binding, PDCD1 is phosphorylated within the ITSM motif, leading to the recruitment of the protein tyrosine phosphatase PTPN11/SHP-2 that mediates dephosphorylation of key TCR proximal signaling molecules, such as ZAP70, PRKCQ/PKCtheta and CD247/CD3zeta (PubMed:32184441)
Subcellular location Cell membrane
Structure Monomer
Post-translational modification Ubiquitinated at Lys-233 by the SCF(FBXO38) complex, leading to its proteasomal degradation (PubMed:30487606). Ubiquitinated via 'Lys-48'-linked polyubiquitin chains (PubMed:30487606). Deubiquitinated and thus stabilized by USP5 (PubMed:37208329) Tyrosine phosphorylated at Tyr-223 (within ITIM motif) and Tyr-248 (ITSM motif) upon ligand binding (PubMed:31754127, PubMed:32184441). Phosphorylation at Tyr-248 by FYN promotes the recruitment of the protein tyrosine phosphatase PTPN11/SHP-2 that mediates dephosphorylation of key TCR proximal signaling molecules, such as ZAP70, PRKCQ/PKCtheta and CD247/CD3zeta (PubMed:32184441). Phosphorylation at Thr-234 promotes the recruitment of the deubiquitinase USP5 (PubMed:37208329) N-glycosylation at Asn-58 contains at least two N-acetylglucosamine units and one fucose (PubMed:28165004). N-glycosylation does not affect binding to nivolumab drug (PubMed:28165004)
Involvement in disease Autoimmune disease, multisystem, infantile-onset, 4 An autosomal recessive immunologic disorder characterized by lymphoproliferative autoimmunity and onset of various autoimmune diseases in early childhood. Death from autoimmune pneumonitis may occur.
Keywords 3D-structure, Adaptive immunity, Apoptosis, Cell membrane, Disulfide bond, Glycoprotein, Immunity, Immunoglobulin domain, Isopeptide bond, Membrane, Phosphoprotein, Proteomics identification, Reference proteome, Signal, Transmembrane, Transmembrane helix, Ubl conjugation
Sequence MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTS ESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGT YLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGS LVLLVWVLAVICSRAARGTIGARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVP CVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL
UniProt accession: Q15116

Data

Formalin-fixed, paraffin-embedded human tonsil stained with anti-PD-1 antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of T-cells

FAQ & Publications

Frequently Asked Questions

What species reactivity and applications is the mouse anti-PD-1 (PDCD1) monoclonal antibody (ZM357) validated for?

This antibody is reactive with human PD-1 and is suitable for immunohistochemistry applications, specifically on formalin-fixed, paraffin-embedded tissues.

How should the mouse anti-PD-1 (PDCD1) monoclonal antibody (ZM357) be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For longer-term preservation, store it at -20°C and avoid repeated freeze-thaw cycles to maintain antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.