Immunohistochemistry (IHC) : Human Ewing’s sarcoma stained with anti-NKX2.2 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of tumor cells.

mouse anti-NKX2.2 monoclonal antibody (ZM14) 6289

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to NKX2.2
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Ewing’s sarcoma
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6289parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, NKX2.2, Soft Tissue Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-NKX2.2 monoclonal antibody ZM14 6289

antibody
Database link: human O95096
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Ewing's sarcoma
Immunogen Human recombinant NKX2.2 protein fragment (aa 1-119)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens NKX2-2 Homeobox protein Nkx-2.2
Protein names Homeobox protein Nkx-2.2
Alternative names Homeobox protein NK-2 homolog B
Gene names NKX2-2
Protein family Belongs to the NK-2 homeobox family
Function Transcriptional activator involved in the development of insulin-producting beta cells in the endocrine pancreas (By similarity). May also be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance. Binds to elements within the NEUROD1 promoter (By similarity)
Subcellular location Nucleus
Structure Interacts with OLIG2
Keywords Activator, Developmental protein, DNA-binding, Homeobox, Nucleus, Proteomics identification, Reference proteome, Transcription, Transcription regulation
Sequence MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLP LKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETPG GGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHR YKMKRARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHALKAQDLAAATFQAGIPFSAYSAQ SLQHMQYNAQYSSASTPQYPTAHPLVQAQQWTW
UniProt accession: O95096

Data

Human Ewing'ss sarcoma stained with anti-NKX2.2 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of tumor cells.

FAQ & Publications

Frequently Asked Questions

What species reactivity is demonstrated by the mouse anti-NKX2.2 monoclonal antibody (ZM14)?

This antibody is reactive with human tissues.

For which application has the mouse anti-NKX2.2 monoclonal antibody been validated?

It has been validated for use in immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

How should the mouse anti-NKX2.2 monoclonal antibody be stored to maintain stability?

Store short term at 2-8°C and for longer term at -20°C, avoiding freeze/thaw cycles.

What is the recommended dilution range for using the concentrated mouse anti-NKX2.2 antibody in IHC?

The recommended dilution for the concentrated antibody is between 1:100 and 1:200.

What control tissue is recommended when using this antibody for immunohistochemistry?

Ewing's sarcoma tissue is recommended as a positive control for this antibody.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.