Skip to content

mouse anti-MiTF (Microphthalmia) monoclonal antibody (C5&D5) 6256

Price range: $160.00 through $528.00

Antibody summary

  • Mouse monoclonal to MiTF (Microphthalmia)
  • Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
  • Reacts with: Human
  • Isotype:IgG1 / IgG1
  • Control: Melanoma
  • Visualization: Nuclear
  • 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

mouse

isotype

IgG1 / IgG1

clonality

monoclonal

concentration

concentrate, predilute

applications

IHC

reactivity

human

available size

0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-MiTF (Microphthalmia) monoclonal antibody C5&D5 6256

antibody
Database link:
human O75030
Tested applications
IHC
Recommended dilutions
Concentrated 1:50-200
Application Notes
Positive control: Melanoma
Immunogen
N-terminal fragment of human Mi protein
Size and concentration
7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form
liquid
Storage Instructions
2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity
affinity purified
Clonality
monoclonal
Isotype
IgG1
Compatible secondaries
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486
goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706
goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control
Mouse monoclonal IgG1 + IgG1 - Isotype C
target relevance
Homo sapiens MITF
Microphthalmia-associated transcription factor
Protein names
Microphthalmia-associated transcription factor
Alternative names
Class E basic helix-loop-helix protein 32
Gene names
MITF
Protein family
Belongs to the MiT/TFE family
Function
Transcription factor that acts as a master regulator of melanocyte survival and differentiation as well as melanosome biogenesis (PubMed:10587587, PubMed:22647378, PubMed:27889061, PubMed:9647758). Binds to M-boxes (5'-TCATGTG-3') and symmetrical DNA sequences (E-boxes) (5'-CACGTG-3') found in the promoter of pigmentation genes, such as tyrosinase (TYR) (PubMed:10587587, PubMed:22647378, PubMed:27889061, PubMed:9647758). Involved in the cellular response to amino acid availability by acting downstream of MTOR: in the presence of nutrients, MITF phosphorylation by MTOR promotes its inactivation (PubMed:36608670). Upon starvation or lysosomal stress, inhibition of MTOR induces MITF dephosphorylation, resulting in transcription factor activity (PubMed:36608670). Plays an important role in melanocyte development by regulating the expression of tyrosinase (TYR) and tyrosinase-related protein 1 (TYRP1) (PubMed:10587587, PubMed:22647378, PubMed:27889061, PubMed:9647758). Plays a critical role in the differentiation of various cell types, such as neural crest-derived melanocytes, mast cells, osteoclasts and optic cup-derived retinal pigment epithelium (PubMed:10587587, PubMed:22647378, PubMed:27889061, PubMed:9647758)
Subcellular location
Nucleus, Cytoplasm, Lysosome membrane
Structure
Homodimer or heterodimer; dimerization is mediated via the coiled coil region (PubMed:24631970). Efficient DNA binding requires dimerization with another bHLH protein (PubMed:14975237). Binds DNA in the form of homodimer or heterodimer with either TFE3, TFEB or TFEC (PubMed:15507434). Interacts with small GTPases Rag (RagA/RRAGA, RagB/RRAGB, RagC/RRAGC and/or RagD/RRAGD); promoting its recruitment to lysosomal membrane in the presence of nutrients (PubMed:23401004, PubMed:36608670). Interacts with KARS1 (PubMed:14975237). Identified in a complex with HINT1 and CTNNB1 (PubMed:22647378). Interacts with VSX2 (By similarity)
Post-translational modification
When nutrients are present, phosphorylation by MTOR at Ser-5 via non-canonical mTORC1 pathway promotes ubiquitination by the SCF(BTRC) complex, followed by degradation (PubMed:36608670). Phosphorylation at Ser-405 significantly enhances the ability to bind the tyrosinase promoter (PubMed:10587587). Phosphorylation by MARK3/cTAK1 at Ser-280 promotes association with 14-3-3/YWHA adapters and retention in the cytosol (PubMed:16822840). Phosphorylated at Ser-180 and Ser-516 following KIT signaling, triggering a short live activation: Phosphorylation at Ser-180 and Ser-516 by MAPK and RPS6KA1, respectively, activate the transcription factor activity but also promote ubiquitination and subsequent degradation by the proteasome (PubMed:10673502). Phosphorylated in response to blue light (415nm) (PubMed:28842328)
Ubiquitinated by the SCF(BTRC) and SCF(FBXW11) complexes following phosphorylation ar Ser-5 by MTOR, leading to its degradation by the proteasome (PubMed:36608670). Ubiquitinated following phosphorylation at Ser-180, leading to subsequent degradation by the proteasome (PubMed:10673502). Deubiquitinated by USP13, preventing its degradation (PubMed:10673502)
Involvement in disease
Waardenburg syndrome 2A
WS2 is a genetically heterogeneous, autosomal dominant disorder characterized by sensorineural deafness, pigmentary disturbances, and absence of dystopia canthorum. The frequency of deafness is higher in WS2 than in WS1.

Tietz albinism-deafness syndrome
An autosomal dominant disorder characterized by generalized hypopigmentation and congenital, bilateral, profound sensorineural deafness.

Melanoma, cutaneous malignant 8
A malignant neoplasm of melanocytes, arising de novo or from a pre-existing benign nevus, which occurs most often in the skin but may also involve other sites.

Coloboma, osteopetrosis, microphthalmia, macrocephaly, albinism, and deafness
An autosomal recessive syndrome characterized by severe microphthalmia, profound congenital sensorineural hearing loss, lack of pigment in the hair, skin, and eyes, macrocephaly, facial dysmorphism, and osteopetrosis.

Keywords
3D-structure, Activator, Albinism, Alternative splicing, Coiled coil, Cytoplasm, Deafness, Developmental protein, Disease variant, DNA-binding, Isopeptide bond, Lysosome, Membrane, Microphthalmia, Nucleus, Osteopetrosis, Phosphoprotein, Proteomics identification, Reference proteome, Transcription, Transcription regulation, Ubl conjugation, Waardenburg syndrome
Sequence
MQSESGIVPDFEVGEEFHEEPKTYYELKSQPLKSSSSAEHPGASKPPISSSSMTSRILLR QQLMREQMQEQERREQQQKLQAAQFMQQRVPVSQTPAINVSVPTTLPSATQVPMEVLKVQ THLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNS PMAMLTLNSNCEKEGFYKFEEQNRAESECPGMNTHSRASCMQMDDVIDDIISLESSYNEE ILGLMDPALQMANTLPVSGNLIDLYGNQGLPPPGLTISNSCPANLPNIKRELTACIFPTE SEARALAKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDY IRKLQREQQRAKELENRQKKLEHANRHLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNR IIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSK LEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHTC
UniProt accession: O75030

Data

Human melanoma stained with MiTF C5/D5 antibodies using peroxidase-conjugate and DAB chromogen. Note nuclear staining of tumor cells.
Human melanoma stained with MiTF C5/D5 antibodies using peroxidase-conjugate and DAB chromogen. Note nuclear staining of tumor cells.

FAQ & Publications

Frequently Asked Questions
What species does the mouse anti-MiTF monoclonal antibody (C5&D5) specifically react with?
This mouse monoclonal antibody to MiTF (Microphthalmia) is validated for reactivity with human tissue.
How should the mouse anti-MiTF monoclonal antibody (C5&D5) be stored to maintain stability?
For short-term storage, keep the antibody at 2-8°C. For long-term preservation, store it at -20°C and avoid repeated freeze/thaw cycles to maintain antibody integrity.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
IHC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.