Immunohistochemistry (IHC) : Human mesothelioma stained with anti-Mesothelin antibody using peroxidase-conjugate and DAB chromogen. Note membranous staining of tumor cells.

mouse anti-Mesothelin monoclonal antibody (ZM25) 6253

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Mesothelin
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2b
Control: Mesothelioma
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6253parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Lung/Mediastinum Pathology, Mesothelin

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2b
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Mesothelin monoclonal antibody ZM25 6253

antibody
Database link: human Q13421
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Mesothelioma
Immunogen Recombinant human mesothelin (MSLN) protein fragment (around aa 273-407)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2b
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2b - Isotype Control

target relevance
Homo sapiens MSLN Mesothelin
Protein names Mesothelin
Alternative names CAK1 antigen, Pre-pro-megakaryocyte-potentiating factor
Gene names MSLN
Protein family Belongs to the mesothelin family
Function Membrane-anchored forms may play a role in cellular adhesion
Subcellular location Secreted
Structure Interacts with MUC16
Post-translational modification Both MPF and the cleaved form of mesothelin are N-glycosylated Proteolytically cleaved by a furin-like convertase to generate megakaryocyte-potentiating factor (MPF), and the cleaved form of mesothelin
Keywords 3D-structure, Alternative splicing, Cell adhesion, Cell membrane, Cleavage on pair of basic residues, Direct protein sequencing, Disulfide bond, Glycoprotein, Golgi apparatus, GPI-anchor, Lipoprotein, Membrane, Phosphoprotein, Proteomics identification, Reference proteome, Secreted, Signal
Sequence MALPTARPLLGSCGTPALGSLLFLLFSLGWVQPSRTLAGETGQEAAPLDGVLANPPNISS LSPRQLLGFPCAEVSGLSTERVRELAVALAQKNVKLSTEQLRCLAHRLSEPPEDLDALPL DLLLFLNPDAFSGPQACTRFFSRITKANVDLLPRGAPERQRLLPAALACWGVRGSLLSEA DVRALGGLACDLPGRFVAESAEVLLPRLVSCPGPLDQDQQEAARAALQGGGPPYGPPSTW SVSTMDALRGLLPVLGQPIIRSIPQGIVAAWRQRSSRDPSWRQPERTILRPRFRREVEKT ACPSGKKAREIDESLIFYKKWELEACVDAALLATQMDRVNAIPFTYEQLDVLKHKLDELY PQGYPESVIQHLGYLFLKMSPEDIRKWNVTSLETLKALLEVNKGHEMSPQAPRRPLPQVA TLIDRFVKGRGQLDKDTLDTLTAFYPGYLCSLSPEELSSVPPSSIWAVRPQDLDTCDPRQ LDVLYPKARLAFQNMNGSEYFVKIQSFLGGAPTEDLKALSQQNVSMDLATFMKLRTDAVL PLTVAEVQKLLGPHVEGLKAEERHRPVRDWILRQRQDDLDTLGLGLQGGIPNGYLVLDLS MQEALSGTPCLLGPGPVLTVLALLLASTLA
UniProt accession: Q13421

Data

Human mesothelioma stained with anti-Mesothelin antibody using peroxidase-conjugate and DAB chromogen. Note membranous staining of tumor cells.

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-Mesothelin monoclonal antibody (ZM25) specifically react with?

The mouse anti-Mesothelin monoclonal antibody (ZM25) specifically reacts with human Mesothelin.

Which applications and tissue preparations is this antibody suitable for?

This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissue samples.

What are the recommended storage conditions for the mouse anti-Mesothelin monoclonal antibody (ZM25)?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C, and freeze/thaw cycles should be avoided.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.