| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG1 |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Lactoferrin |
| available sizes | 100 µg |
mouse anti-Lactoferrin monoclonal antibody (2B8) 3782
$235.00
Antibody summary
- Mouse monoclonal to Lactoferrin
- Suitable for: WB,ELISA
- Isotype: IgG1
- 100 µg
mouse anti-Lactoferrin monoclonal antibody (2B8) 3782
| antibody |
|---|
| Tested applications WB,ELISA |
| Recommended dilutions This antibody may be used in immuno-assays to detect and quantitate human lactoferrin. Not all applications have been investigated. |
| Immunogen Purified lactoferrin from human milk. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions These antibodies are stable for at least one (1) year at -20°C to -70°C. Store product in appropriate aliquots to avoid multiple freeze-thaw cycles. |
| Storage buffer PBS containing 0.1% NaN3 |
| Purity protein affinity purification |
| Clonality monoclonal |
| Isotype IgG1 |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG1 - Isotype Control |
| target relevance |
|---|
| Homo sapiens LTF Lactotransferrin |
| Protein names Lactotransferrin |
| Alternative names Growth-inhibiting protein 12, Talalactoferrin |
| Gene names LTF |
| Protein family Belongs to the transferrin family |
| Function Transferrins are iron binding transport proteins which can bind two Fe(3+) ions in association with the binding of an anion, usually bicarbonate |
| Subcellular location Cytoplasm, Nucleus |
| Structure (Microbial infection) Interacts (via N-terminus) with Human adenovirus C serotype 5 hexon protein; this interaction seems to be part of the mechanisms of cellular entry by the virus |
| Post-translational modification Phosphorylation at Ser-10 activates the transcriptional activity (PubMed:20404350). Phosphorylation at Ser-10 also promotes proteasomal degradation (PubMed:20404350). Alternatively can undergo O-GlcNAcylation at Ser-10 (PubMed:20404350) O-GlcNAcylation at Ser-10 inhibits DNA binding and negatively regulates the transcriptional activity (PubMed:20404350). Alternatively can undergo phosphorylation at Ser-10 (PubMed:20404350) Poly-N-acetyllactosaminic carbohydrate moiety seems to be needed for TLR4 activation |
| Keywords 3D-structure, Alternative promoter usage, Antibiotic, Antimicrobial, Cytoplasm, Direct protein sequencing, Disulfide bond, DNA-binding, Glycoprotein, Heparin-binding, Hydrolase, Immunity, Ion transport, Iron, Iron transport, Isopeptide bond, Metal-binding, Nucleus, Osteogenesis, Protease, Proteomics identification, Reference proteome, Repeat, Secreted, Serine protease, Signal, Transcription, Transcription regulation, Transport, Ubl conjugation |
| Sequence MKLVFLVLLFLGALGLCLAGRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDS PIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKG GSFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGA DKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDVAFIRESTVFEDLSDE AERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKD KSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTAIQNLRKSEEEVAAR RARVVWCAVGEQELRKCNQWSGLSEGSVTCSSASTTEDCIALVLKGEADAMSLDGGYVYT AGKCGLVPVLAENYKSQQSSDPDPNCVDRPVEGYLAVAVVRRSDTSLTWNSVKGKKSCHT AVDRTAGWNIPMGLLFNQTGSCKFDEYFSQSCAPGSDPRSNLCALCIGDEQGENKCVPNS NERYYGYTGAFRCLAENAGDVAFVKDVTVLQNTDGNNNEAWAKDLKLADFALLCLDGKRK PVTEARSCHLAMAPNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNL LFNDNTECLARLHGKTTYEKYLGPQYVAGITNLKKCSTSPLLEACEFLRK |
| UniProt accession: P02788 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What species does the mouse anti-Lactoferrin monoclonal antibody (2B8) specifically target?
This monoclonal antibody is reactive with human lactoferrin, allowing for detection and quantitation in human samples.
Which experimental applications has the mouse anti-Lactoferrin antibody (2B8) been validated for?
The antibody has been tested and is suitable for Western blotting (WB) and ELISA assays. It may also be used in immunocytochemistry/immunofluorescence (ICC/IF), although not all applications have been fully investigated.
How should the mouse anti-Lactoferrin monoclonal antibody be stored to maintain stability?
Store the antibody in aliquots at temperatures between -20°C and -70°C to avoid multiple freeze-thaw cycles. Under these conditions, the antibody remains stable for at least one year.
What is the host species and clonality of the anti-Lactoferrin antibody (2B8)?
The antibody is a mouse-derived monoclonal antibody with an IgG1 isotype.
What immunogen was used to generate the mouse anti-Lactoferrin monoclonal antibody (2B8)?
The immunogen used was purified lactoferrin protein isolated from human milk.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.