Immunohistochemistry (IHC) : Human kidney stained with anti-Erythropoietin antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of tubular cells.

mouse anti-Erythropoietin monoclonal antibody (ZM135) 6178

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Erythropoietin
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Kidney
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6178parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Erythropoietin, Urinary Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Erythropoietin monoclonal antibody ZM135 6178

antibody
Database link: human P01588
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Kidney
Immunogen Recombinant fragment of human EPO protein (around aa 28-162)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens EPO Erythropoietin
Protein names Erythropoietin
Gene names EPO
Protein family Belongs to the EPO/TPO family
Function Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass (PubMed:28283061). Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3 (PubMed:9774108)
Subcellular location Secreted
Involvement in disease Microvascular complications of diabetes 2 Pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis. Erythrocytosis, familial, 5 An autosomal dominant disorder characterized by elevated serum hemoglobin and hematocrit. Some patients have increased serum erythropoietin levels. Diamond-Blackfan anemia-like An autosomal recessive hematologic disease characterized by severe red cell hypoplastic anemia, selective absence of red cell precursors and progenitors seen on bone marrow biopsy, and increased serum erythropoietin.
Keywords 3D-structure, Congenital erythrocytosis, Direct protein sequencing, Disease variant, Disulfide bond, Erythrocyte maturation, Glycoprotein, Hormone, Pharmaceutical, Proteomics identification, Reference proteome, Secreted, Signal
Sequence MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHC SLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQL HVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKL KLYTGEACRTGDR
UniProt accession: P01588

Data

Human kidney stained with anti-Erythropoietin antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of tubular cells.

FAQ & Publications

Frequently Asked Questions

What is the recommended application for the mouse anti-Erythropoietin monoclonal antibody (ZM135) 6178?

This antibody is suitable for immunohistochemistry (IHC) applications, specifically on formalin-fixed, paraffin-embedded human tissue samples.

How should the mouse anti-Erythropoietin antibody be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For longer-term preservation, store it at -20°C and avoid repeated freeze/thaw cycles to maintain antibody integrity.

Which species does the mouse anti-Erythropoietin monoclonal antibody (ZM135) specifically react with?

This monoclonal antibody reacts specifically with human erythropoietin.

What is the immunogen used to generate the mouse anti-Erythropoietin monoclonal antibody (ZM135)?

The immunogen is a recombinant fragment of the human erythropoietin protein, covering approximately amino acids 28 to 162.

Is this antibody monoclonal or polyclonal, and what is its isotype?

The antibody is a mouse monoclonal antibody of the IgG1 isotype.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.