Immunohistochemistry (IHC) : Human prostate tissue stained with anti-Keratin 5/6 antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of basal cells.

mouse anti-Cytokeratin 5/6 monoclonal antibody (D5&16B4) 6147

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Cytokeratin 5/6
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Mesothelioma, prostate
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6147parent Category: antibody Tags: anatomy, Cytokeratin 5/6, General & Epithelial Markers

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Cytokeratin 5/6 monoclonal antibody D5&16B4 6147

antibody
Database link: human P01732 human P01731
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Mesothelioma, prostate
Immunogen Isolated Cytokeratin 5
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Protein names T-cell surface glycoprotein CD8 alpha chain (T-lymphocyte differentiation antigen T8/Leu-2) (CD antigen CD8a)
Gene names CD8A,CD8A MAL
Mass 25729Da
Catalytic activity CD8A MAL
Pathway 9606
Subellular location CD8A MAL
Domain MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Target Relevance information above includes information from UniProt accession: P01732
The UniProt Consortium

Data

Human prostate tissue stained with anti-Keratin 5/6 antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of basal cells.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.