Weight | 1 lbs |
---|---|
Dimensions | 9 × 5 × 2 in |
host | mouse |
isotype | IgG1 |
clonality | monoclonal |
concentration | concentrate, predilute |
applications | IHC |
reactivity | human |
available size | 0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted |
mouse anti-Cytokeratin 5/6 monoclonal antibody (D5&16B4) 6147
Price range: $160.00 through $528.00
Antibody summary
- Mouse monoclonal to Cytokeratin 5/6
- Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
- Reacts with: Human
- Isotype:IgG1
- Control: Mesothelioma, prostate
- Visualization: Cytoplasmic
- 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
mouse anti-Cytokeratin 5/6 monoclonal antibody D5&16B4 6147
target relevance |
---|
Protein names T-cell surface glycoprotein CD8 alpha chain (T-lymphocyte differentiation antigen T8/Leu-2) (CD antigen CD8a) |
Gene names CD8A,CD8A MAL |
Mass 25729Da |
Catalytic activity CD8A MAL |
Pathway 9606 |
Subellular location CD8A MAL |
Domain MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV |
Target Relevance information above includes information from UniProt accession: P01732 |
The UniProt Consortium |
Data
![]() |
Human prostate tissue stained with anti-Keratin 5/6 antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of basal cells. |
Publications
Publications
pmid | title | authors | citation |
---|---|---|---|
We haven't added any publications to our database yet. |
Protocols
relevant to this product |
---|
IHC |
Documents
# | SDS | Certificate | |
---|---|---|---|
Please enter your product and batch number here to retrieve product datasheet, SDS, and QC information. |
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.