Immunohistochemistry (IHC) : Human thyroid gland stained with anti-keratin 18 antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of glandular cells.

mouse anti-Cytokeratin 18 monoclonal antibody (DC10) 6139

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Cytokeratin 18
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Breast carcinoma
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6139parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Cytokeratin 18, General & Epithelial Markers

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Cytokeratin 18 monoclonal antibody DC10 6139

antibody
Database link: human P05783
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Breast carcinoma
Immunogen Human breast cancer PMC 42 cells
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens KRT18 Keratin, type I cytoskeletal 18
Protein names Keratin, type I cytoskeletal 18
Alternative names Cell proliferation-inducing gene 46 protein, Cytokeratin-18, Keratin-18
Gene names KRT18
Protein family Belongs to the intermediate filament family
Function Required for the formation of KRT8/KRT18 filaments that are involved in ARHGEF40-mediated actin stress fiber formation and tensional force-induced stress fiber formation and reinforcement (PubMed:26823019). Also acts downstream of ROCK kinase activation as part of a positive feedback mechanism in response to cellular mechanical stress loading (PubMed:26823019). Organization and orientation of KRT18 filaments are responsible for the properly elongated morphology of epithelial tubules (By similarity). Involved in the uptake of thrombin-antithrombin complexes by hepatic cells (By similarity). When phosphorylated, plays a role in filament reorganization. Involved in the delivery of mutated CFTR to the plasma membrane. Together with KRT8, is involved in interleukin-6 (IL-6)-mediated barrier protection
Subcellular location Nucleus matrix, Cytoplasm, perinuclear region, Nucleus, nucleolus, Cytoplasm
Structure (Microbial infection) Interacts with hepatitis C virus/HCV core protein
Post-translational modification Phosphorylation at Ser-34 increases during mitosis. Hyperphosphorylated at Ser-53 in diseased cirrhosis liver. Phosphorylation increases by IL-6 Proteolytically cleaved by caspases during epithelial cell apoptosis. Cleavage occurs at Asp-238 by either caspase-3, caspase-6 or caspase-7 O-GlcNAcylation increases solubility, and decreases stability by inducing proteasomal degradation
Involvement in disease Cirrhosis A liver disease characterized by severe panlobular liver-cell swelling with Mallory body formation, prominent pericellular fibrosis, and marked deposits of copper. Clinical features include abdomen swelling, jaundice and pulmonary hypertension.
Keywords Acetylation, Cell cycle, Coiled coil, Cytoplasm, Direct protein sequencing, Disease variant, Glycoprotein, Host-virus interaction, Intermediate filament, Isopeptide bond, Keratin, Methylation, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Ubl conjugation
Sequence MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGS GGLATGIAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLESKIREHLEKKG PQVRDWSHYFKIIEDLRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVEN DIHGLRKVIDDTNITRLQLETEIEALKEELLFMKKNHEEEVKGLQAQIASSGLTVEVDAP KSQDLAKIMADIRAQYDELARKNREELDKYWSQQIEESTTVVTTQSAEVGAAETTLTELR RTVQSLEIDLDSMRNLKASLENSLREVEARYALQMEQLNGILLHLESELAQTRAEGQRQA QEYEALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIVDGKVVS ETNDTKVLRH
UniProt accession: P05783

Data

Human thyroid gland stained with anti-keratin 18 antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of glandular cells.

FAQ & Publications

Frequently Asked Questions

What is the recommended application and dilution for the mouse anti-Cytokeratin 18 monoclonal antibody (DC10)?

This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues. The recommended dilution for the concentrated form is between 1:100 and 1:200.

How should the mouse anti-Cytokeratin 18 monoclonal antibody (DC10) be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be stored at -20°C. Avoid repeated freeze/thaw cycles to preserve antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.