Skip to content

mouse anti-Cytokeratin 14 monoclonal antibody (LL002) 6135

Price range: $160.00 through $528.00

Antibody summary

  • Mouse monoclonal to Cytokeratin 14
  • Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
  • Reacts with: Human
  • Isotype:IgG3
  • Control: Skin, tonsil or squamous cell carcinoma
  • Visualization: Cytoplasmic
  • 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
SKU: 6135parent Categories: , Tags: , ,
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

mouse

isotype

IgG3

clonality

monoclonal

concentration

concentrate, predilute

applications

IHC

reactivity

human

available size

0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Cytokeratin 14 monoclonal antibody LL002 6135

antibody
Database link:
human P02533
Tested applications
IHC
Recommended dilutions
Concentrated 1:100-300
Application Notes
Positive control: Skin, tonsil or squamous cell carcinoma
Immunogen
A synthetic peptide of 15 amino acid residues from the C-terminus of human keratin 14
Size and concentration
7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form
liquid
Storage Instructions
2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity
affinity purified
Clonality
monoclonal
Isotype
IgG3
Compatible secondaries
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486
goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706
goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control
Mouse monoclonal IgG3 - Isotype Control
target relevance
Homo sapiens KRT14
Keratin, type I cytoskeletal 14
Protein names
Keratin, type I cytoskeletal 14
Alternative names
Cytokeratin-14, Keratin-14
Gene names
KRT14
Protein family
Belongs to the intermediate filament family
Function
The nonhelical tail domain is involved in promoting KRT5-KRT14 filaments to self-organize into large bundles and enhances the mechanical properties involved in resilience of keratin intermediate filaments in vitro
Subcellular location
Cytoplasm, Nucleus
Structure
Heterotetramer of two type I and two type II keratins (By similarity). Forms a disulfide-linked heterodimer (via 2B domains) with KRT5 (via 2B domains) (PubMed:22705788, PubMed:24940650). Forms a heterodimer with KRT1; the interaction is more abundant in the absence of KRT5 (By similarity). Interacts with PLEC isoform 1C, when in a heterodimer with KRT5 (PubMed:24940650). Interacts with TRADD and with keratin filaments (PubMed:11684708). Associates with other type I keratins (PubMed:11724817). Interacts with EPPK1 (By similarity). Interacts with KLHL24 (PubMed:27798626). Interacts with PKP1 (via N-terminus) and PKP2 (PubMed:10852826)
Post-translational modification
A disulfide bond is formed between rather than within filaments and promotes the formation of a keratin filament cage around the nucleus
Ubiquitinated by the BCR(KLHL24) E3 ubiquitin ligase complex
Involvement in disease
Epidermolysis bullosa simplex 1A, generalized severe
A form of epidermolysis bullosa simplex, a group of skin fragility disorders characterized by skin blistering due to cleavage within the basal layer of keratinocytes, and erosions caused by minor mechanical trauma. There is a broad spectrum of clinical severity ranging from minor blistering on the feet, to subtypes with extracutaneous involvement and a lethal outcome. EBS1A is an autosomal dominant form characterized by generalized intraepidermal skin blistering that begins and is very prominent at birth. EBS1A may be life-threatening in the first year of life. Tendency to blistering diminishes in adolescence.

Epidermolysis bullosa simplex 1C, localized
A form of epidermolysis bullosa simplex, a group of skin fragility disorders characterized by skin blistering due to cleavage within the basal layer of keratinocytes, and erosions caused by minor mechanical trauma. There is a broad spectrum of clinical severity ranging from minor blistering on the feet, to subtypes with extracutaneous involvement and a lethal outcome. EBS1C is an autosomal dominant form with intraepidermal blistering mainly restricted to hands and feet beginning in infancy. Nails may be thick and dystrophic.

Epidermolysis bullosa simplex 1B, generalized intermediate
A form of epidermolysis bullosa simplex, a group of skin fragility disorders characterized by skin blistering due to cleavage within the basal layer of keratinocytes, and erosions caused by minor mechanical trauma. There is a broad spectrum of clinical severity ranging from minor blistering on the feet, to subtypes with extracutaneous involvement and a lethal outcome. EBS1B is an autosomal dominant form characterized by generalized intraepidermal blistering beginning at birth. The tendency to blistering diminishes in adolescence, when it may become localized to hands and feet.

Epidermolysis bullosa simplex 1D, generalized, intermediate or severe, autosomal recessive
A form of epidermolysis bullosa simplex, a group of skin fragility disorders characterized by skin blistering due to cleavage within the basal layer of keratinocytes, and erosions caused by minor mechanical trauma. There is a broad spectrum of clinical severity ranging from minor blistering on the feet, to subtypes with extracutaneous involvement and a lethal outcome. EBS1D is an autosomal recessive form characterized by blistering beginning at birth or early childhood. In some patients hands and feet are primarily affected, and in others blistering anywhere on the body may occur. In some patients the condition improves with age.

Naegeli-Franceschetti-Jadassohn syndrome
A rare autosomal dominant form of ectodermal dysplasia. The cardinal features are absence of dermatoglyphics (fingerprints), reticular cutaneous hyperpigmentation (starting at about the age of 2 years without a preceding inflammatory stage), palmoplantar keratoderma, hypohidrosis with diminished sweat gland function and discomfort provoked by heat, nail dystrophy, and tooth enamel defects.

Dermatopathia pigmentosa reticularis
A rare ectodermal dysplasia characterized by lifelong persistent reticulate hyperpigmentation, non-cicatricial alopecia, and nail dystrophy. Variable features include adermatoglyphia, hypohidrosis or hyperhidrosis, and palmoplantar hyperkeratosis.

Keywords
3D-structure, Coiled coil, Cytoplasm, Disease variant, Disulfide bond, Ectodermal dysplasia, Epidermolysis bullosa, Intermediate filament, Keratin, Nucleus, Palmoplantar keratoderma, Phosphoprotein, Proteomics identification, Reference proteome, Ubl conjugation
Sequence
MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGLSVSSSRFSSG GACGLGGGYGGGFSSSSSSFGSGFGGGYGGGLGAGLGGGFGGGFAGGDGLLVGSEKVTMQ NLNDRLASYLDKVRALEEANADLEVKIRDWYQRQRPAEIKDYSPYFKTIEDLRNKILTAT VDNANVLLQIDNARLAADDFRTKYETELNLRMSVEADINGLRRVLDELTLARADLEMQIE SLKEELAYLKKNHEEEMNALRGQVGGDVNVEMDAAPGVDLSRILNEMRDQYEKMAEKNRK DAEEWFFTKTEELNREVATNSELVQSGKSEISELRRTMQNLEIELQSQLSMKASLENSLE ETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLE GEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN
UniProt accession: P02533

Data

Human breast stained with Keratin 14 using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of myoepithelial cells.
Human breast stained with Keratin 14 using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of myoepithelial cells.

FAQ & Publications

Frequently Asked Questions
What species does the mouse anti-Cytokeratin 14 monoclonal antibody (LL002) specifically react with?
This antibody specifically reacts with human Cytokeratin 14.
Which applications are suitable for using this antibody?
The antibody is suitable for Immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.
How should the mouse anti-Cytokeratin 14 monoclonal antibody be stored to maintain stability?
For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C, avoiding freeze/thaw cycles.
What are the available formats and concentrations for this Cytokeratin 14 antibody?
The antibody is available as concentrated solutions in 0.1 mL, 0.5 mL, and 1.0 mL sizes, as well as a 7 mL prediluted format.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
IHC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.