Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human solitary fibrous tumor stained with anti-ALDH1A1 monoclonal antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic/nuclear staining of tumor cells

mouse anti-ALDH1A1 monoclonal antibody (ZM71) 6015

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to ALDH1A1
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Solitary fibrous tumor
Visualization: Cytoplasmic and nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6015parent Categories: antibody, Zeta IHC antibodies Tags: ALDH1A1, anatomy, Soft Tissue Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-ALDH1A1 monoclonal antibody ZM71 6015

antibody
Database link: human P00352
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Solitary fibrous tumor
Immunogen Recombinant full-length human ALDH1A1 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens ALDH1A1 Aldehyde dehydrogenase 1A1
Protein names Aldehyde dehydrogenase 1A1
Alternative names 3-deoxyglucosone dehydrogenase, ALDH-E1, ALHDII, Aldehyde dehydrogenase family 1 member A1, Aldehyde dehydrogenase, cytosolic, Retinal dehydrogenase 1
Gene names ALDH1A1
Protein family Belongs to the aldehyde dehydrogenase family
Function Cytosolic dehydrogenase that catalyzes the irreversible oxidation of a wide range of aldehydes to their corresponding carboxylic acid (PubMed:12941160, PubMed:15623782, PubMed:17175089, PubMed:19296407, PubMed:25450233, PubMed:26373694). Functions downstream of retinol dehydrogenases and catalyzes the oxidation of retinaldehyde into retinoic acid, the second step in the oxidation of retinol/vitamin A into retinoic acid (By similarity). This pathway is crucial to control the levels of retinol and retinoic acid, two important molecules which excess can be teratogenic and cytotoxic (By similarity). Also oxidizes aldehydes resulting from lipid peroxidation like (E)-4-hydroxynon-2-enal/HNE, malonaldehyde and hexanal that form protein adducts and are highly cytotoxic. By participating for instance to the clearance of (E)-4-hydroxynon-2-enal/HNE in the lens epithelium prevents the formation of HNE-protein adducts and lens opacification (PubMed:12941160, PubMed:15623782, PubMed:19296407). Also functions downstream of fructosamine-3-kinase in the fructosamine degradation pathway by catalyzing the oxidation of 3-deoxyglucosone, the carbohydrate product of fructosamine 3-phosphate decomposition, which is itself a potent glycating agent that may react with lysine and arginine side-chains of proteins (PubMed:17175089). Also has an aminobutyraldehyde dehydrogenase activity and is probably part of an alternative pathway for the biosynthesis of GABA/4-aminobutanoate in midbrain, thereby playing a role in GABAergic synaptic transmission (By similarity)
Catalytic activity an aldehyde + NAD(+) + H2O = a carboxylate + NADH + 2 H(+) all-trans-retinal + NAD(+) + H2O = all-trans-retinoate + NADH + 2 H(+) 9-cis-retinal + NAD(+) + H2O = 9-cis-retinoate + NADH + 2 H(+) 11-cis-retinal + NAD(+) + H2O = 11-cis-retinoate + NADH + 2 H(+) 13-cis-retinal + NAD(+) + H2O = 13-cis-retinoate + NADH + 2 H(+) 3-deoxyglucosone + NAD(+) + H2O = 2-dehydro-3-deoxy-D-gluconate + NADH + 2 H(+) (E)-4-hydroxynon-2-enal + NAD(+) + H2O = (E)-4-hydroxynon-2-enoate + NADH + 2 H(+) malonaldehyde + NAD(+) + H2O = 3-oxopropanoate + NADH + 2 H(+) hexanal + NAD(+) + H2O = hexanoate + NADH + 2 H(+) propanal + NAD(+) + H2O = propanoate + NADH + 2 H(+) acetaldehyde + NAD(+) + H2O = acetate + NADH + 2 H(+) benzaldehyde + NAD(+) + H2O = benzoate + NADH + 2 H(+) 4-aminobutanal + NAD(+) + H2O = 4-aminobutanoate + NADH + 2 H(+)
Subcellular location Cytoplasm, cytosol, Cell projection, axon
Structure Homotetramer (By similarity). Interacts with PRMT3; the interaction is direct, inhibits ALDH1A1 aldehyde dehydrogenase activity and is independent of the methyltransferase activity of PRMT3 (PubMed:33495566)
Post-translational modification The N-terminus is blocked most probably by acetylation
Keywords 3D-structure, Acetylation, Cell projection, Cytoplasm, Direct protein sequencing, Lipid metabolism, NAD, Nucleotide-binding, Oxidoreductase, Phosphoprotein, Proteomics identification, Reference proteome
Sequence MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDV DKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYL NDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKI GPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDID KVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQG QCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIES GKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKR ANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGE YGFHEYTEVKTVTVKISQKNS
UniProt accession: P00352

Data

Formalin-fixed, paraffin-embedded human solitary fibrous tumor stained with anti-ALDH1A1 monoclonal antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic/nuclear staining of tumor cells

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-ALDH1A1 monoclonal antibody (ZM71) specifically react with?

This antibody is reactive with human tissues.

What are the recommended storage conditions for the mouse anti-ALDH1A1 monoclonal antibody to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be stored at -20°C, and freeze/thaw cycles should be avoided.

Which applications and sample types has this antibody been validated for?

The mouse anti-ALDH1A1 monoclonal antibody (ZM71) is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissue samples.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.