Weight | 1 lbs |
---|---|
Dimensions | 9 × 5 × 2 in |
host | mouse |
isotype | IgG2a |
clonality | monoclonal |
concentration | 1 mg/mL |
applications | ELISA, ICC/IF, WB |
available sizes | 1 mg, 100 µg, 25 µg |
mouse anti-GST monoclonal antibody (GST.B6) 8446
$100.00 – $2,600.00
Antibody summary
- Mouse monoclonal to GST
- Suitable for: WB,ICC/IF,ELISA
- Reacts with: tagged fusion proteins
- Isotype: IgG2a
- 100 µg, 25 µg, 1 mg
mouse anti-GST monoclonal antibody (GST.B6) 8446
antibody |
---|
Database link: GST tag P08515 Sequence- MSPILGYWKIKGLVQPTRLLLEYLEEKYEE HLYERDEGDKWRNKKFELGLEFPNLPYYID GDVKLTQSMAIIRYIADKHNMLGGCPKERA EISMLEGAVLDIRYGVSRIAYSKDFETLKV DFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFK KRIEAIPQIDKYLKSSKYIAWPLQGWQATF GGGDHPPKSD |
Tested applications WB,ICC/IF,ELISA |
Recommended dilutions WB: 1:1000-3000 ICC/IF: 1:500-2000 |
Immunogen Highly purified Glutathione-S-transferase (GST) from Schistosoma japonicum |
Size and concentration 25, 100, 1000µg and 1 mg/mL |
Form liquid |
Storage buffer PBS, pH 7.2, 0.05% NaN3 |
Purity affinity purified |
Clonality monoclonal |
Isotype IgG2a |
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
Isotype control Mouse monocolonal IgG2a - Isotype Control |
target relevance |
---|
GST can be used as a tag to aid in the expression and folding of fusion proteins. This antibody can be used to confirm expression and quantify the GST tagged recombinant proteins in Western blotting and for their purification/copurification. When imaging in situ, GST tagged proteins can be identified by this antibody when used in conjunction with a suitable secondary antibody. Click for more on: epitope tags and GST tag |
Biotechnology GST fusion proteins, referring to Glutathione S-transferase fusion proteins, have become invaluable tools in molecular biology and biotechnology. GST, an enzyme naturally present in cells, is fused with the protein of interest to facilitate recombinant protein production and purification. The GST tag not only enhances the solubility and stability of the target protein but also allows for easy isolation using affinity chromatography with glutathione-linked resin. The specific and high-affinity interaction between GST and glutathione simplifies the purification process, resulting in highly pure and functional fusion proteins. Moreover, GST fusion proteins are widely used in protein-protein interaction studies, as they can help identify binding partners and elucidate complex signaling pathways. Additionally, GST fusion proteins serve as efficient antigens for generating antibodies, enabling researchers to produce specific and high-quality antibodies for various applications. The versatility and ease of use of GST fusion proteins make them indispensable in a wide range of research endeavors, from understanding protein function to drug discovery and beyond. |
Data
1:5,000 (0.2µg/mL) Ab dilution probed against BL-21 bacteria lysate expressing the GST protein. |
Publications
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from PubMed database provided by The United States National Library of Medicine at the National Institutes of Health.pmid | title | authors | citation |
---|
Protocols
relevant to this product |
---|
Western blot ICC |
Documents
# | |||
---|---|---|---|
No results found |
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.